GAS8-AS1 (GAS8 antisense RNA 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 750 |
| Gene name | GAS8 antisense RNA 1 |
| Gene symbol | GAS8-AS1 |
| Synonyms (NCBI Gene) |
C16orf3
|
| Chromosome | 16 |
| Chromosome location | 16q24.3 |
| Summary | This gene encodes a long non-coding RNA (lncRNA) that may function as a tumor suppressor. Mutations in this gene have been identified in human papillary thyroid carcinoma (PTC) patients that abrogate the ability of encoded lncRNA to inhibit cancer cell gr |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
O95177 |
| Protein name | Uncharacterized protein GAS8-AS1 (GAS8 antisense RNA 1) (GAS8 antisense gene protein 1) |
| Family and domains | |
| Sequence |
MKLSSAAGQESPGHPHPSPPAWTLKKPSESVAQRAMCSARACPVACPVGCPAACPVGCPI |
| Sequence length | 125 |
| Interactions | View interactions |
|
Associated diseases
Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Evidence Score:
★☆☆☆☆ Gene-disease association found in Text Mining only
★★☆☆☆ Found in Text Mining and Unknown/Other Associations
★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources
★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Related Genes
Genes most often co-reported with GAS8-AS1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to GAS8-AS1 (see Related Genes above), that are NOT already directly curated for GAS8-AS1 itself -- a lead worth checking, not a confirmed association.
0
|
|