GAGE4 (G antigen 4)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 2576 |
| Gene name | G antigen 4 |
| Gene symbol | GAGE4 |
| Synonyms (NCBI Gene) |
CT4.4
|
| Chromosome | X |
| Chromosome location | Xp11.4-p11.2 |
| Summary | This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic pepti |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
|
|||||||||||||||||||||
|
|||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P0DSO3 |
| Protein name | G antigen 4 (Cancer/testis antigen 4.4) (CT4.4) |
| Protein function | Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes. |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in a variety of tumor tissues but not in normal tissues, except testis. {ECO:0000269|PubMed:7544395}. |
| Sequence |
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE |
| Sequence length | 117 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with GAGE4 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to GAGE4 (see Related Genes above), that are NOT already directly curated for GAGE4 itself -- a lead worth checking, not a confirmed association.
0
|
|