Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	2534
Gene name	FYN proto-oncogene, Src family tyrosine kinase
Gene symbol	FYN
Synonyms (NCBI Gene)	SLKSYNp59-FYN
Chromosome	6
Chromosome location	6q21
Summary	This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and

Show/Hide all (33)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022048	hsa-miR-128-3p	Microarray	17612493
MIRT038910	hsa-miR-93-3p	CLASH	23622248
MIRT437821	hsa-miR-125a-3p	Luciferase reporter assay	23606749
MIRT437821	hsa-miR-125a-3p	Luciferase reporter assay	23606749
MIRT699208	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT699207	hsa-miR-34c-3p	HITS-CLIP	23313552
MIRT699205	hsa-miR-6760-3p	HITS-CLIP	23313552
MIRT699206	hsa-miR-1208	HITS-CLIP	23313552
MIRT699204	hsa-miR-431-5p	HITS-CLIP	23313552
MIRT699203	hsa-miR-584-5p	HITS-CLIP	23313552
MIRT699202	hsa-miR-3924	HITS-CLIP	23313552
MIRT699201	hsa-miR-500a-3p	HITS-CLIP	23313552
MIRT699200	hsa-let-7a-2-3p	HITS-CLIP	23313552
MIRT699199	hsa-let-7g-3p	HITS-CLIP	23313552
MIRT732298	hsa-miR-106b-5p	Luciferase reporter assayWestern blot	27520374
MIRT732298	hsa-miR-106b-5p	Luciferase reporter assayWestern blot	27520374
MIRT699208	hsa-miR-5580-3p	HITS-CLIP	23313552
MIRT699207	hsa-miR-34c-3p	HITS-CLIP	23313552
MIRT699205	hsa-miR-6760-3p	HITS-CLIP	23313552
MIRT699206	hsa-miR-1208	HITS-CLIP	23313552
MIRT699204	hsa-miR-431-5p	HITS-CLIP	23313552
MIRT699203	hsa-miR-584-5p	HITS-CLIP	23313552
MIRT699202	hsa-miR-3924	HITS-CLIP	23313552
MIRT699201	hsa-miR-500a-3p	HITS-CLIP	23313552
MIRT699200	hsa-let-7a-2-3p	HITS-CLIP	23313552
MIRT699199	hsa-let-7g-3p	HITS-CLIP	23313552
MIRT1007638	hsa-miR-3159	CLIP-seq
MIRT1007639	hsa-miR-33a	CLIP-seq
MIRT1007640	hsa-miR-33b	CLIP-seq
MIRT2536015	hsa-miR-2053	CLIP-seq
MIRT2536016	hsa-miR-4282	CLIP-seq
MIRT2536015	hsa-miR-2053	CLIP-seq
MIRT2536016	hsa-miR-4282	CLIP-seq

176

Show/Hide all (176)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000304	Process	Response to singlet oxygen	IEA
GO:0000304	Process	Response to singlet oxygen	ISS	27525436
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0001664	Function	G protein-coupled receptor binding	IPI	23169819
GO:0001764	Process	Neuron migration	IEA
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	TAS
GO:0003015	Process	Heart process	IEA
GO:0003015	Process	Heart process	IGI	27525436
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	1381360, 9799234, 10861086, 11110698, 11448999, 12923167, 16921024, 18697750, 27692963
GO:0004713	Function	Protein tyrosine kinase activity	IDA	15713798
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IMP	16979591
GO:0004713	Function	Protein tyrosine kinase activity	ISS	17526495
GO:0004713	Function	Protein tyrosine kinase activity	TAS	1361685, 17526495, 28386764
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IBA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	11606584
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	NAS	7822789
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	1661130, 1715582, 7685273, 7687537, 9045636, 9195899, 9360983, 9763511, 10209036, 10383400, 10409671, 10790433, 10867021, 11741929, 12721299, 12788081, 14757743, 14993658, 15784897, 16115884, 16374509, 16479011, 16636290, 16713569, 16777849, 16831868, 16899217, 16964398, 16966330, 17
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS	27525436
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS	27525436
GO:0005768	Component	Endosome	IDA	15611048
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005884	Component	Actin filament	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12150984, 15611048
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006816	Process	Calcium ion transport	NAS	7822789
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	IDA	24012003
GO:0007411	Process	Axon guidance	TAS
GO:0007612	Process	Learning	TAS	1361685
GO:0007631	Process	Feeding behavior	TAS	8264796
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010730	Process	Negative regulation of hydrogen peroxide biosynthetic process	IEA
GO:0010730	Process	Negative regulation of hydrogen peroxide biosynthetic process	ISS	27525436
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0015631	Function	Tubulin binding	IEA
GO:0016004	Function	Phospholipase activator activity	IDA	11606584
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	ISS
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	27525436
GO:0021819	Process	Layer formation in cerebral cortex	ISS
GO:0030101	Process	Natural killer cell activation	IDA	15169881, 15713798, 27249817
GO:0030101	Process	Natural killer cell activation	IDA	15713798
GO:0030154	Process	Cell differentiation	IBA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030425	Component	Dendrite	IDA	24012003
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030900	Process	Forebrain development	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0031295	Process	T cell costimulation	TAS
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031802	Function	Type 5 metabotropic glutamate receptor binding	IEA
GO:0031802	Function	Type 5 metabotropic glutamate receptor binding	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	11606584
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0035556	Process	Intracellular signal transduction	TAS	1361685
GO:0036120	Process	Cellular response to platelet-derived growth factor stimulus	IEA
GO:0038026	Process	Reelin-mediated signaling pathway	IEA
GO:0038026	Process	Reelin-mediated signaling pathway	ISS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042177	Process	Negative regulation of protein catabolic process	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042608	Function	T cell receptor binding	IEA
GO:0042609	Function	CD4 receptor binding	IEA
GO:0042610	Function	CD8 receptor binding	IEA
GO:0042802	Function	Identical protein binding	IPI	14993658, 25156556, 27001024
GO:0043014	Function	Alpha-tubulin binding	IEA
GO:0043014	Function	Alpha-tubulin binding	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0043274	Function	Phospholipase binding	IPI	11606584
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IEA
GO:0044297	Component	Cell body	IEA
GO:0044297	Component	Cell body	ISS
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045121	Component	Membrane raft	IDA	12150984
GO:0045121	Component	Membrane raft	IDA	12218089
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	IMP	23386614
GO:0045121	Component	Membrane raft	ISS
GO:0045121	Component	Membrane raft	TAS	28386764
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	10498895
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048156	Function	Tau protein binding	IEA
GO:0048156	Function	Tau protein binding	ISS
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048156	Function	Tau protein binding	TAS	25707991
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS	27525436
GO:0048813	Process	Dendrite morphogenesis	IEA
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0050852	Process	T cell receptor signaling pathway	IBA
GO:0050852	Process	T cell receptor signaling pathway	IDA	7722293
GO:0050900	Process	Leukocyte migration	TAS
GO:0050966	Process	Detection of mechanical stimulus involved in sensory perception of pain	IEA
GO:0051428	Function	Peptide hormone receptor binding	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	ISS	27525436
GO:0070851	Function	Growth factor receptor binding	IPI	16479011
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071375	Process	Cellular response to peptide hormone stimulus	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	IEA
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS
GO:0097038	Component	Perinuclear endoplasmic reticulum	IEA
GO:0097038	Component	Perinuclear endoplasmic reticulum	ISS	27525436
GO:0097062	Process	Dendritic spine maintenance	TAS	25707991
GO:0097110	Function	Scaffold protein binding	IPI	23555801
GO:0097386	Component	Glial cell projection	IEA
GO:0097386	Component	Glial cell projection	ISS
GO:0097718	Function	Disordered domain specific binding	IPI	9351809
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099092	Component	Postsynaptic density, intracellular component	IEA
GO:1900182	Process	Positive regulation of protein localization to nucleus	IEA
GO:1900449	Process	Regulation of glutamate receptor signaling pathway	IEA
GO:1900449	Process	Regulation of glutamate receptor signaling pathway	ISS
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	ISS	27525436
GO:1902951	Process	Negative regulation of dendritic spine maintenance	IEA
GO:1902951	Process	Negative regulation of dendritic spine maintenance	ISS
GO:1904645	Process	Response to amyloid-beta	IEA
GO:1904645	Process	Response to amyloid-beta	ISS
GO:1904646	Process	Cellular response to amyloid-beta	IMP	27520374
GO:1905232	Process	Cellular response to L-glutamate	IEA
GO:1905232	Process	Cellular response to L-glutamate	ISS	17526495
GO:1905430	Process	Cellular response to glycine	IEA
GO:1905430	Process	Cellular response to glycine	ISS	17526495
GO:1905477	Process	Positive regulation of protein localization to membrane	TAS	28386764
GO:1905664	Process	Regulation of calcium ion import across plasma membrane	IEA
GO:1905664	Process	Regulation of calcium ion import across plasma membrane	ISS
GO:2001222	Process	Regulation of neuron migration	ISS
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA

MIM	HGNC	e!Ensembl
137025	4037	ENSG00000010810

P06241

Protein name

Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)

Protein function

Non-receptor tyrosine-protein kinase that plays a role in many biological processes including regulation of cell growth and survival, cell adhesion, integrin-mediated signaling, cytoskeletal remodeling, cell motility, immune response and axon gu

PDB

1A0N , 1AOT , 1AOU , 1AVZ , 1AZG , 1EFN , 1FYN , 1G83 , 1M27 , 1NYF , 1NYG , 1SHF , 1ZBJ , 2DQ7 , 2MQI , 2MRJ , 2MRK , 3H0F , 3H0H , 3H0I , 3UA6 , 3UA7 , 4D8D , 4EIK , 4U17 , 4U1P , 4ZNX , 5ZAU , 6EDF , 6IPY , 6IPZ , 7A2J , 7A2K , 7A2L , 7A2M , 7A2N , 7A2O , 7A2P , 7A2Q , 7A2R , 7A2S , 7A2T , 7A2U , 7A2V , 7A2W , 7A2X , 7A2Y , 7A2Z , 7UD6 , 8KDX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	88 → 135	SH3 domain	Domain
PF00017	SH2	149 → 231	SH2 domain	Domain
PF07714	PK_Tyr_Ser-Thr	271 → 520	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is highly expressed in the brain. Isoform 2 is expressed in cells of hemopoietic lineages, especially T-lymphocytes. {ECO:0000269|PubMed:10196263}.

Sequence

MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL

Sequence length

537

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
EBV-positive nodal T- and NK-cell lymphoma	Pathogenic	rs1351655525, rs370573757	RCV004560282 RCV004560283 RCV004560284	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian failure	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (132)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	17943724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	17943724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	2121537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	26437031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	28978570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	30658076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	22927204, 28033507, 32751526, 35563596, 36258016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29467305, 30549331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	19404734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	27177312		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31232492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	24626634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33430905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17703099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17703099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	11315256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24626634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28922833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	36039581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	17943724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	19330793, 19468241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19330793, 19468241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	26786295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	17320499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	9844106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19404734, 24882577, 27349276, 29066500, 29348460, 30789269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19404734, 21480388, 37958964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29453318	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33987980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39795978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	26786295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29937990, 31285693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36708583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36905103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36708583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	CTD_human_DG	16407246		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	29981838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	24243499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	BEFREE	24243499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	30836997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25526346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	23922104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	30127215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30130557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18805444, 29693170, 32811808, 33987980, 36510452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	26669670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	35327643, 36258016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	19953343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33890634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24098138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24098138, 25371288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28990106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38194422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	24927707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28922833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23716303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15994925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22323579, 26136341, 39946771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15994925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21480388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12881301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	11477536	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33325804	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30130557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29446765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	32945445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37965330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27566560, 28978570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26848862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	26924014, 29246765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29360191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19955046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18337055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19404734, 24882577, 27349276, 29066500, 29348460, 30789269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29937990, 31285693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17943724, 18990162, 26624980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29140740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	26786295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17567567, 18990162, 26848862, 27349276, 3070044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24882577, 29066500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	22354875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	35240786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14717778, 9217182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23469041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23469041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28713962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37274867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17943724, 23716303, 24882577, 29140740, 29413048, 7723281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12450793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30130557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26646899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26646899, 34964707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	24882577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37140355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	17320499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33213062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	21480388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11193173, 11733371, 14720204, 18650345, 19018246, 23223297, 26924014, 27671864, 28460160, 28990084, 29241709, 29246765, 31148150		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	BEFREE	20493840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	24413734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	CTD_human_DG	24413734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17943724, 18990162, 26624980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	18990162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	17943724, 31530281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17943724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18990162	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37771187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	24303025	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	30658076		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	33325804	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	35839307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11121167, 19102774, 19468241, 19501919, 31498476		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19102774, 19501919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28991256, 30285260		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary Parkinson Disease	Parkinson disease	BEFREE	31846630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shy-Drager Syndrome	Shy-Drager Syndrome	BEFREE	20493840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30746237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30784933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12771142, 24192080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 26811494	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tauopathies	Tauopathies	BEFREE	28033507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29140740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29140740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	37197658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26786295, 36530656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	24597767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FYN (FYN proto-oncogene, Src family tyrosine kinase)