FXYD6P3 (FXYD domain containing ion transport regulator 6 pseudogene 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 406875
Gene name FXYD domain containing ion transport regulator 6 pseudogene 3
Gene symbol FXYD6P3
Synonyms (NCBI Gene)
FXYD8
Chromosome X
Chromosome location Xq13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IEA
GO:0006811 Process Monoatomic ion transport IEA
GO:0016020 Component Membrane IEA
GO:0017080 Function Sodium channel regulator activity IBA
GO:0034220 Process Monoatomic ion transmembrane transport IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 31124 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P58550
Protein name Putative FXYD domain-containing ion transport regulator 8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02038 ATP1G1_PLM_MAT8 24 → 70 ATP1G1/PLM/MAT8 family Family
Sequence 
MEVVLIFVYSLLVPVVLASAAKEKEIDPFHYNYQTLRIGGLVFDVVLFLVPSCHLLSHRC
KCSFNQKPQDPGDKEAQVENFITANAKEPQKAKN
Sequence length 94
Interactions View interactions

No strongly related genes found yet for FXYD6P3.

No additional diseases found yet through genes similar to FXYD6P3.