FUOM (fucose mutarotase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 282969
• Gene name: Fucose mutarotase
• Gene symbol: FUOM
• Synonyms (NCBI Gene): C10orf125, FUCU, FucM
• Chromosome: 10
• Chromosome location: 10q26.3

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005996	Process	Monosaccharide metabolic process	IEA
GO:0006004	Process	Fucose metabolic process	IBA
GO:0006004	Process	Fucose metabolic process	IEA
GO:0006004	Process	Fucose metabolic process	ISS
GO:0016853	Function	Isomerase activity	IEA
GO:0016857	Function	Racemase and epimerase activity, acting on carbohydrates and derivatives	IBA
GO:0016857	Function	Racemase and epimerase activity, acting on carbohydrates and derivatives	IEA
GO:0016857	Function	Racemase and epimerase activity, acting on carbohydrates and derivatives	ISS
GO:0030182	Process	Neuron differentiation	IEA
GO:0036065	Process	Fucosylation	IBA
GO:0036065	Process	Fucosylation	IEA
GO:0036373	Function	L-fucose mutarotase activity	IEA
GO:0036373	Function	L-fucose mutarotase activity	ISS
GO:0042352	Process	GDP-L-fucose salvage	IEA
GO:0042806	Function	Fucose binding	IBA
GO:0042806	Function	Fucose binding	IEA
GO:0042806	Function	Fucose binding	ISS
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0048029	Function	Monosaccharide binding	IEA
GO:0060180	Process	Female mating behavior	IEA

Other IDs

• MIM: 617725
• HGNC: 24733
• e!Ensembl: ENSG00000148803

Protein

• UniProt ID: A2VDF0
• Protein name: Fucose mutarotase (EC 5.1.3.29)
• Protein function: Involved in the interconversion between alpha- and beta-L-fucoses. L-Fucose (6-deoxy-L-galactose) exists as alpha-L-fucose (29.5%) and beta-L-fucose (70.5%), the beta-form is metabolized through the salvage pathway. GDP-L-fucose formed either by
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05025	RbsD_FucU	5 → 148	RbsD / FucU transport protein family	Family

• Sequence:

  MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLE
  AVLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFY
  ERAKKAFAVVATGETALYGNLILRKGVLALNPLL

• Sequence length: 154

Pathways

Reactome Pathway:

GDP-fucose biosynthesis

Related Genes

No strongly related genes found yet for FUOM.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FUOM.