Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	389844
Gene name	Ferritin heavy chain 1 pseudogene 19
Gene symbol	FTH1P19
Synonyms (NCBI Gene)	FTHL19
Chromosome	X
Chromosome location	Xp21.1

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence
GO:0004322	Function	Ferroxidase activity	IEA
GO:0005506	Function	Iron ion binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0006826	Process	Iron ion transport	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IEA
GO:0008198	Function	Ferrous iron binding	IBA
GO:0008199	Function	Ferric iron binding	IBA
GO:0008199	Function	Ferric iron binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	33525	N/A

P0C7X4

Protein name

Putative ferritin heavy polypeptide-like 19 (Ferritin heavy polypeptide 1 pseudogene 19)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00210	Ferritin	1 → 122	Ferritin-like domain	Domain

Sequence

MAFYFDQDDAALEHFDRYFLRQSQEKREHAQELMSLQNLRGGRICLHDIRKPEGQGWESG
LKAMECTFHLEKNINQSLLELHQLARENGDPQLCDFLENDFLNQQAKTIKELGGYLSNLH
KMGAPEAGLAEYLFNKLTLGRSQKHTRAQTGPTATGCLPLLAPPGGTSMFPFQNILFIFL
LSVLPLLAIKLSVLKAIKVSS

Sequence length

201

Interactions

View interactions

Related Genes Genes most often co-reported with FTH1P19 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for FTH1P19.

Diseases Linked via Similar Genes Diseases curated for genes most similar to FTH1P19 (see Related Genes above), that are NOT already directly curated for FTH1P19 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to FTH1P19.

FTH1P19 (ferritin heavy chain 1 pseudogene 19)

Save This Analysis