Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	29999
Gene name	Fascin actin-bundling protein 3
Gene symbol	FSCN3
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7q32.1

20 Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IBA
GO:0003779	Function	Actin binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	10783262
GO:0005902	Component	Microvillus	IBA
GO:0007015	Process	Actin filament organization	IEA
GO:0007163	Process	Establishment or maintenance of cell polarity	IBA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0016477	Process	Cell migration	IBA
GO:0030027	Component	Lamellipodium	IBA
GO:0030175	Component	Filopodium	IBA
GO:0030426	Component	Growth cone	IBA
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0031253	Component	Cell projection membrane	IBA
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IEA
GO:0051017	Process	Actin filament bundle assembly	IBA

MIM	HGNC	e!Ensembl
615800	3961	ENSG00000106328

Q9NQT6

Protein name

Fascin-3 (Testis fascin)

Protein function

Acts as an actin bundling protein.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06268	Fascin	271 → 381	Fascin domain	Domain
PF06268	Fascin	24 → 138	Fascin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis.

Sequence

MDETEWIHRHPKAEDLRVGLISWAGTYLTFEACKNTVTATAKSLGRRQTWEILVSNEHET
QAVVRLKSVQGLYLLCECDGTVCYGRPRTSHHGCFLLRFHRNSKWTLQCLISGRYLESNG
KDVFCTSHVLSAYHMWTPRPALHVHVILYSPIHRCYARADPTMGRIWVDAAVPCLEECGF
LLHFRDGCYHLETSTHHFLSHVDRLFSQPSSQTAFHMQVRPGGLVALCDGEGGMLYPQGT
HLLLGMGCNPMRGEEWFILQHCPTWVSLRSKTGRFISVIYDGEVRAASERLNRMSLFQFE
CDSESPTVQLRSANGYYLSQRRHRAVMADGHPLESDTFFRMHWNCGRIILQSCRGRFLGI
APNSLLMANVILPGPNEEFGILFANRSFLVLRGRYGYVGSSSGHDLIQCNQDQPDRIHLL
PCRPGIYHFQAQGGSFWSITSFGTFRPWGKFALNFCIELQGSNLLTVLAPNGFYMRADQS
GTLLADSEDITRECIWEF

Sequence length

498

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (6)
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	35764056	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	35764056	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	GWAS catalog	38036781	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	40325049	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Uncertain significance	ClinVar Disgenet	—	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	23532257, 26818947, 35956399, 38685053	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	17029629	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26818947	★★★★★ ★☆☆☆☆ Found in Text Mining only

FSCN3 (fascin actin-bundling protein 3)

Bookmark This Gene