FOXS1 (forkhead box S1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2307
• Gene name: Forkhead box S1
• Gene symbol: FOXS1
• Synonyms (NCBI Gene): FKHL18, FREAC10
• Chromosome: 20
• Chromosome location: 20q11.21
• Summary: The forkhead family of transcription factors belongs to the winged helix class of DNA-binding proteins. The protein encoded by this intronless gene contains a forkhead domain and is found predominantly in aorta and kidney. The function of the encoded prot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1003864	hsa-miR-1915	CLIP-seq
MIRT1003865	hsa-miR-2861	CLIP-seq
MIRT1003866	hsa-miR-3064-5p	CLIP-seq
MIRT1003867	hsa-miR-3663-3p	CLIP-seq
MIRT1003868	hsa-miR-4663	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0001568	Process	Blood vessel development	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9325056
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0030154	Process	Cell differentiation	IBA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	ISS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0050885	Process	Neuromuscular process controlling balance	IEA

Other IDs

• MIM: 602939
• HGNC: 3735
• e!Ensembl: ENSG00000179772

Protein

• UniProt ID: O43638
• Protein name: Forkhead box protein S1 (Forkhead-like 18 protein) (Forkhead-related transcription factor 10) (FREAC-10)
• Protein function: Transcriptional repressor that suppresses transcription from the FASLG, FOXO3 and FOXO4 promoters. May have a role in the organization of the testicular vasculature (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	17 → 103	Forkhead domain	Domain

• Sequence:

  MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRP
  GWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGA
  EGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPA
  TTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSP
  ESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWV
  AGGFPVQGGSGYPLGLTPCLYRTPGMFFFE

• Sequence length: 330

Related Genes

No strongly related genes found yet for FOXS1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FOXS1.