FOXO3B (forkhead box O3B)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 2310
Gene name Forkhead box O3B
Gene symbol FOXO3B
Synonyms (NCBI Gene)
FKHRL1P1ZNF286C
Chromosome 17
Chromosome location 17p11.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620471 3822 ENSG00000240445
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A2Z4LIS9
Protein name Forkhead box protein O3B
Protein function Transcription factor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 242 → 288 Forkhead domain Domain
Sequence 
METDLAEMPEKGVLSSQDSPHFQEKSTEEGEVAALRLTARSQAAAAAAAPGSRSLRGVHV
PPPLHPAPAREESARTPAAAGRAAKMAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPL
QRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSRTLVSGLLLE
DSVRVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRN
AWGNLSYADLITRAIESSPDRRLTLSQIYEWMVSCVPYFKDKGNSNSSAG
Sequence length 290
Interactions View interactions

No strongly related genes found yet for FOXO3B.

No additional diseases found yet through genes similar to FOXO3B.