FOXO3 (forkhead box O3)

Gene

• Entrez ID: 2309
• Gene name: Forkhead box O3
• Gene symbol: FOXO3
• Synonyms (NCBI Gene): AF6q21, FKHRL1, FKHRL1P2, FOXO2, FOXO3A
• Chromosome: 6
• Chromosome location: 6q21
• Summary: This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000671	hsa-miR-182-5p	Luciferase reporter assay, Western blot	19188590
MIRT000671	hsa-miR-182-5p	Luciferase reporter assay, Western blot	19188590
MIRT000671	hsa-miR-182-5p	Review	19935707
MIRT004495	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	20371610
MIRT000434	hsa-miR-221-3p	qRT-PCR, ChIP, Luciferase reporter assay, Western blot, Northern blot	20388878
MIRT000433	hsa-miR-222-3p	qRT-PCR, ChIP, Luciferase reporter assay, Western blot, Northern blot	20388878
MIRT004495	hsa-miR-155-5p	qRT-PCR, Luciferase reporter assay, Western blot	20371610
MIRT004495	hsa-miR-155-5p	Flow, Immunoblot, Immunofluorescence, Immunohistochemistry, Microarray, qRT-PCR, Western blot	21304824
MIRT004495	hsa-miR-155-5p	Flow, Immunoblot, Immunofluorescence, Immunohistochemistry, Microarray, qRT-PCR, Western blot	21304824
MIRT004495	hsa-miR-155-5p	Flow, Immunoblot, Immunofluorescence, Immunohistochemistry, Microarray, qRT-PCR, Western blot	21304824
MIRT004495	hsa-miR-155-5p	Flow, Immunoblot, Immunofluorescence, Immunohistochemistry, Microarray, qRT-PCR, Western blot	21304824
MIRT004198	hsa-miR-197-3p	Microarray	16822819
MIRT005450	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	21203424
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22095742
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22095742
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22084234
MIRT006284	hsa-miR-23a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22095742
MIRT007326	hsa-miR-9-5p	Luciferase reporter assay	23509296
MIRT017201	hsa-miR-335-5p	Microarray	18185580
MIRT004495	hsa-miR-155-5p	Other	20584899
MIRT004495	hsa-miR-155-5p	Proteomics	19650740
MIRT051735	hsa-let-7c-5p	CLASH	23622248
MIRT050180	hsa-miR-26a-5p	CLASH	23622248
MIRT039975	hsa-miR-615-3p	CLASH	23622248
MIRT037525	hsa-miR-744-5p	CLASH	23622248
MIRT053249	hsa-miR-126-3p	In situ hybridization, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23603512
MIRT054878	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Western blot	24467486
MIRT004495	hsa-miR-155-5p	qRT-PCR	23250986
MIRT000671	hsa-miR-182-5p	Luciferase reporter assay	23262295
MIRT000671	hsa-miR-182-5p	Luciferase reporter assay	23262295
MIRT004495	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	23970205
MIRT438227	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT438106	ptr-miR-182	Immunoblot, Luciferase reporter assay, qRT-PCR	24871856
MIRT315221	hsa-miR-217	Luciferase reporter assay, Western blot, qRT_PCR	24376725
MIRT315221	hsa-miR-217	Luciferase reporter assay, Western blot, qRT_PCR	24376725
MIRT004495	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	23970205
MIRT438227	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT438106	ptr-miR-182	Immunoblot, Luciferase reporter assay, qRT-PCR	24871856
MIRT315221	hsa-miR-217	Luciferase reporter assay, Western blot, qRT_PCR	24376725
MIRT315221	hsa-miR-217	Luciferase reporter assay, Western blot, qRT_PCR	24376725
MIRT668271	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT668270	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT668269	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT668268	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT668267	hsa-miR-1976	HITS-CLIP	23824327
MIRT677038	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT677037	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT677036	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT677035	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT668266	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT668265	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT668264	hsa-miR-4279	HITS-CLIP	23824327
MIRT677034	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT668263	hsa-miR-498	HITS-CLIP	23824327
MIRT668271	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT668270	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT668269	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT668268	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT668267	hsa-miR-1976	HITS-CLIP	23824327
MIRT668266	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT668265	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT668264	hsa-miR-4279	HITS-CLIP	23824327
MIRT668263	hsa-miR-498	HITS-CLIP	23824327
MIRT658090	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT658089	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT217310	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT563752	hsa-miR-100-3p	PAR-CLIP	20371350
MIRT217307	hsa-miR-21-5p	PAR-CLIP	20371350
MIRT217309	hsa-miR-590-5p	PAR-CLIP	20371350
MIRT315203	hsa-miR-4714-3p	PAR-CLIP	20371350
MIRT563751	hsa-miR-4275	PAR-CLIP	20371350
MIRT563750	hsa-miR-4328	PAR-CLIP	20371350
MIRT544600	hsa-miR-1179	PAR-CLIP	20371350
MIRT544599	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT544598	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT217321	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT315219	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT217323	hsa-miR-621	PAR-CLIP	20371350
MIRT544596	hsa-miR-6069	PAR-CLIP	20371350
MIRT217322	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT544595	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT544600	hsa-miR-1179	PAR-CLIP	20371350
MIRT544599	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT544598	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT217321	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT217322	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT544595	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT315226	hsa-miR-548av-3p	PAR-CLIP	20371350
MIRT562329	hsa-miR-6882-5p	PAR-CLIP	20371350
MIRT562328	hsa-miR-1228-3p	PAR-CLIP	20371350
MIRT409789	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT409790	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT409792	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT562327	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT409788	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT409793	hsa-miR-6079	PAR-CLIP	20371350
MIRT544600	hsa-miR-1179	PAR-CLIP	21572407
MIRT544599	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT544598	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT217321	hsa-miR-126-5p	PAR-CLIP	21572407
MIRT544597	hsa-miR-665	PAR-CLIP	21572407
MIRT315219	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT217323	hsa-miR-621	PAR-CLIP	21572407
MIRT544596	hsa-miR-6069	PAR-CLIP	21572407
MIRT217322	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT544595	hsa-miR-4795-3p	PAR-CLIP	21572407
MIRT440613	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440613	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT004198	hsa-miR-197-3p	Microarray, qRT-PCR, Western blot	26540468
MIRT004495	hsa-miR-155-5p	Luciferase reporter assay	27091996
MIRT004495	hsa-miR-155-5p	Luciferase reporter assay	27091996
MIRT005450	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	25369914
MIRT005450	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	25369914
MIRT004495	hsa-miR-155-5p	Luciferase reporter assay	28006785
MIRT004495	hsa-miR-155-5p	Luciferase reporter assay	28006785
MIRT004495	hsa-miR-155-5p	Luciferase reporter assay	28401267
MIRT004495	hsa-miR-155-5p	Luciferase reporter assay	28401267
MIRT054878	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR	31733095
MIRT734522	hsa-miR-100-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33520966
MIRT007326	hsa-miR-9-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32612392
MIRT735726	hsa-miR-629-3p	Western blotting, qRT-PCR, Flow cytometry	31853302
MIRT734701	hsa-miR-155-3p	Western blotting, qRT-PCR	31828217
MIRT005450	hsa-miR-96-5p	Luciferase reporter assay, Western blotting, In situ hybridization	31598681
MIRT438227	hsa-miR-223-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31695022
MIRT736845	hsa-miR-182-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR	33997179
MIRT004495	hsa-miR-155-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33742606
MIRT005450	hsa-miR-96-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32100957
MIRT734701	hsa-miR-155-3p	Western blotting, qRT-PCR	32284792
MIRT668271	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT668270	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT668269	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT668268	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT668267	hsa-miR-1976	HITS-CLIP	23824327
MIRT677038	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT677037	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT677036	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT677035	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT668266	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT668265	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT668264	hsa-miR-4279	HITS-CLIP	23824327
MIRT677034	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT668263	hsa-miR-498	HITS-CLIP	23824327
MIRT668271	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT668270	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT668269	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT668268	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT668267	hsa-miR-1976	HITS-CLIP	23824327
MIRT668266	hsa-miR-520a-5p	HITS-CLIP	23824327
MIRT668265	hsa-miR-525-5p	HITS-CLIP	23824327
MIRT668264	hsa-miR-4279	HITS-CLIP	23824327
MIRT668263	hsa-miR-498	HITS-CLIP	23824327
MIRT658090	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT658089	hsa-miR-3927-5p	HITS-CLIP	23824327
MIRT217310	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT563752	hsa-miR-100-3p	PAR-CLIP	20371350
MIRT217307	hsa-miR-21-5p	PAR-CLIP	20371350
MIRT217309	hsa-miR-590-5p	PAR-CLIP	20371350
MIRT315203	hsa-miR-4714-3p	PAR-CLIP	20371350
MIRT563751	hsa-miR-4275	PAR-CLIP	20371350
MIRT563750	hsa-miR-4328	PAR-CLIP	20371350
MIRT544600	hsa-miR-1179	PAR-CLIP	20371350
MIRT544599	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT544598	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT217321	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT315219	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT217323	hsa-miR-621	PAR-CLIP	20371350
MIRT544596	hsa-miR-6069	PAR-CLIP	20371350
MIRT217322	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT544595	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT544600	hsa-miR-1179	PAR-CLIP	20371350
MIRT544599	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT544598	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT217321	hsa-miR-126-5p	PAR-CLIP	20371350
MIRT217322	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT544595	hsa-miR-4795-3p	PAR-CLIP	20371350
MIRT315226	hsa-miR-548av-3p	PAR-CLIP	20371350
MIRT562329	hsa-miR-6882-5p	PAR-CLIP	20371350
MIRT562328	hsa-miR-1228-3p	PAR-CLIP	20371350
MIRT409789	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT409790	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT409792	hsa-miR-4786-3p	PAR-CLIP	20371350
MIRT562327	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT409788	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT409793	hsa-miR-6079	PAR-CLIP	20371350
MIRT544600	hsa-miR-1179	PAR-CLIP	21572407
MIRT544599	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT544598	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT217321	hsa-miR-126-5p	PAR-CLIP	21572407
MIRT544597	hsa-miR-665	PAR-CLIP	21572407
MIRT315219	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT217323	hsa-miR-621	PAR-CLIP	21572407
MIRT544596	hsa-miR-6069	PAR-CLIP	21572407
MIRT217322	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT544595	hsa-miR-4795-3p	PAR-CLIP	21572407
MIRT755523	hsa-miR-301a-3p	Luciferase reporter assay, Western blotting, qRT-PCR, RNA-seq, In situ hybridization, RNA pull down assay	38630149
MIRT755764	hsa-miR-874-3p	Luciferase reporter assay, Western blotting, Flow cytometry	37272921
MIRT217307	hsa-miR-21-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	34786052
MIRT004495	hsa-miR-155-5p	qRT-PCR	36071352
MIRT1002892	hsa-miR-1183	CLIP-seq
MIRT1002893	hsa-miR-1202	CLIP-seq
MIRT1002894	hsa-miR-1207-5p	CLIP-seq
MIRT1002895	hsa-miR-1208	CLIP-seq
MIRT1002896	hsa-miR-1270	CLIP-seq
MIRT1002897	hsa-miR-1278	CLIP-seq
MIRT1002898	hsa-miR-1279	CLIP-seq
MIRT1002899	hsa-miR-1283	CLIP-seq
MIRT1002900	hsa-miR-1284	CLIP-seq
MIRT1002901	hsa-miR-1293	CLIP-seq
MIRT1002902	hsa-miR-1303	CLIP-seq
MIRT1002903	hsa-miR-139-5p	CLIP-seq
MIRT1002904	hsa-miR-153	CLIP-seq
MIRT1002905	hsa-miR-1912	CLIP-seq
MIRT1002906	hsa-miR-1915	CLIP-seq
MIRT1002907	hsa-miR-194	CLIP-seq
MIRT1002908	hsa-miR-2116	CLIP-seq
MIRT1002909	hsa-miR-221	CLIP-seq
MIRT1002910	hsa-miR-222	CLIP-seq
MIRT1002911	hsa-miR-25	CLIP-seq
MIRT1002912	hsa-miR-28-3p	CLIP-seq
MIRT1002913	hsa-miR-29a	CLIP-seq
MIRT1002914	hsa-miR-29b	CLIP-seq
MIRT1002915	hsa-miR-29c	CLIP-seq
MIRT1002916	hsa-miR-302a	CLIP-seq
MIRT1002917	hsa-miR-302b	CLIP-seq
MIRT1002918	hsa-miR-302c	CLIP-seq
MIRT1002919	hsa-miR-302d	CLIP-seq
MIRT1002920	hsa-miR-302e	CLIP-seq
MIRT1002921	hsa-miR-3065-3p	CLIP-seq
MIRT1002922	hsa-miR-3065-5p	CLIP-seq
MIRT1002923	hsa-miR-3074-3p	CLIP-seq
MIRT1002924	hsa-miR-30a	CLIP-seq
MIRT1002925	hsa-miR-30b	CLIP-seq
MIRT1002926	hsa-miR-30c	CLIP-seq
MIRT1002927	hsa-miR-30d	CLIP-seq
MIRT1002928	hsa-miR-30e	CLIP-seq
MIRT1002929	hsa-miR-3120-3p	CLIP-seq
MIRT1002930	hsa-miR-3124-3p	CLIP-seq
MIRT1002931	hsa-miR-3125	CLIP-seq
MIRT1002932	hsa-miR-3130-5p	CLIP-seq
MIRT1002933	hsa-miR-3168	CLIP-seq
MIRT1002934	hsa-miR-3180-5p	CLIP-seq
MIRT1002935	hsa-miR-32	CLIP-seq
MIRT1002936	hsa-miR-320a	CLIP-seq
MIRT1002937	hsa-miR-320b	CLIP-seq
MIRT1002938	hsa-miR-320c	CLIP-seq
MIRT1002939	hsa-miR-320d	CLIP-seq
MIRT1002940	hsa-miR-320e	CLIP-seq
MIRT1002941	hsa-miR-34b	CLIP-seq
MIRT1002942	hsa-miR-34c-3p	CLIP-seq
MIRT1002943	hsa-miR-3591-3p	CLIP-seq
MIRT1002944	hsa-miR-3607-3p	CLIP-seq
MIRT1002945	hsa-miR-3617	CLIP-seq
MIRT1002946	hsa-miR-363	CLIP-seq
MIRT1002947	hsa-miR-3662	CLIP-seq
MIRT1002948	hsa-miR-367	CLIP-seq
MIRT1002949	hsa-miR-3675-3p	CLIP-seq
MIRT1002950	hsa-miR-3685	CLIP-seq
MIRT1002951	hsa-miR-3686	CLIP-seq
MIRT1002952	hsa-miR-3689a-5p	CLIP-seq
MIRT1002953	hsa-miR-3689b	CLIP-seq
MIRT1002954	hsa-miR-3689e	CLIP-seq
MIRT1002955	hsa-miR-3689f	CLIP-seq
MIRT1002956	hsa-miR-3714	CLIP-seq
MIRT1002957	hsa-miR-372	CLIP-seq
MIRT1002958	hsa-miR-373	CLIP-seq
MIRT1002959	hsa-miR-384	CLIP-seq
MIRT1002960	hsa-miR-3907	CLIP-seq
MIRT1002961	hsa-miR-3916	CLIP-seq
MIRT1002962	hsa-miR-3936	CLIP-seq
MIRT1002963	hsa-miR-3972	CLIP-seq
MIRT1002964	hsa-miR-3977	CLIP-seq
MIRT1002965	hsa-miR-412	CLIP-seq
MIRT1002966	hsa-miR-421	CLIP-seq
MIRT1002967	hsa-miR-4272	CLIP-seq
MIRT1002968	hsa-miR-4291	CLIP-seq
MIRT1002969	hsa-miR-4318	CLIP-seq
MIRT1002970	hsa-miR-4418	CLIP-seq
MIRT1002971	hsa-miR-4420	CLIP-seq
MIRT1002972	hsa-miR-4427	CLIP-seq
MIRT1002973	hsa-miR-4429	CLIP-seq
MIRT1002974	hsa-miR-4433	CLIP-seq
MIRT1002975	hsa-miR-4434	CLIP-seq
MIRT1002976	hsa-miR-4436a	CLIP-seq
MIRT1002977	hsa-miR-4457	CLIP-seq
MIRT1002978	hsa-miR-448	CLIP-seq
MIRT1002979	hsa-miR-4482	CLIP-seq
MIRT1002980	hsa-miR-4483	CLIP-seq
MIRT1002981	hsa-miR-4493	CLIP-seq
MIRT1002982	hsa-miR-4504	CLIP-seq
MIRT1002983	hsa-miR-450b-5p	CLIP-seq
MIRT1002984	hsa-miR-4516	CLIP-seq
MIRT1002985	hsa-miR-4531	CLIP-seq
MIRT1002986	hsa-miR-4639-3p	CLIP-seq
MIRT1002987	hsa-miR-4645-5p	CLIP-seq
MIRT1002988	hsa-miR-4652-3p	CLIP-seq
MIRT1002989	hsa-miR-4663	CLIP-seq
MIRT1002990	hsa-miR-4666-5p	CLIP-seq
MIRT1002991	hsa-miR-4673	CLIP-seq
MIRT1002992	hsa-miR-4680-3p	CLIP-seq
MIRT1002993	hsa-miR-4693-5p	CLIP-seq
MIRT1002994	hsa-miR-4694-5p	CLIP-seq
MIRT1002995	hsa-miR-4699-3p	CLIP-seq
MIRT1002996	hsa-miR-4727-5p	CLIP-seq
MIRT1002997	hsa-miR-4731-3p	CLIP-seq
MIRT1002998	hsa-miR-4742-5p	CLIP-seq
MIRT1002999	hsa-miR-4753-3p	CLIP-seq
MIRT1003000	hsa-miR-4755-3p	CLIP-seq
MIRT1003001	hsa-miR-4763-3p	CLIP-seq
MIRT1003002	hsa-miR-4775	CLIP-seq
MIRT1003003	hsa-miR-4778-5p	CLIP-seq
MIRT1003004	hsa-miR-4789-3p	CLIP-seq
MIRT1003005	hsa-miR-4801	CLIP-seq
MIRT1003006	hsa-miR-495	CLIP-seq
MIRT1003007	hsa-miR-507	CLIP-seq
MIRT1003008	hsa-miR-509-3-5p	CLIP-seq
MIRT1003009	hsa-miR-509-5p	CLIP-seq
MIRT1003010	hsa-miR-519a	CLIP-seq
MIRT1003011	hsa-miR-519b-3p	CLIP-seq
MIRT1003012	hsa-miR-519c-3p	CLIP-seq
MIRT1003013	hsa-miR-520a-3p	CLIP-seq
MIRT1003014	hsa-miR-520b	CLIP-seq
MIRT1003015	hsa-miR-520c-3p	CLIP-seq
MIRT1003016	hsa-miR-520d-3p	CLIP-seq
MIRT1003017	hsa-miR-520d-5p	CLIP-seq
MIRT1003018	hsa-miR-520e	CLIP-seq
MIRT1003019	hsa-miR-520f	CLIP-seq
MIRT1003020	hsa-miR-524-5p	CLIP-seq
MIRT1003021	hsa-miR-545	CLIP-seq
MIRT1003022	hsa-miR-548an	CLIP-seq
MIRT1003023	hsa-miR-548v	CLIP-seq
MIRT1003024	hsa-miR-553	CLIP-seq
MIRT1003025	hsa-miR-555	CLIP-seq
MIRT1003026	hsa-miR-557	CLIP-seq
MIRT1003027	hsa-miR-586	CLIP-seq
MIRT1003028	hsa-miR-587	CLIP-seq
MIRT1003029	hsa-miR-590-3p	CLIP-seq
MIRT1003030	hsa-miR-620	CLIP-seq
MIRT1003031	hsa-miR-641	CLIP-seq
MIRT1003032	hsa-miR-642b	CLIP-seq
MIRT1003033	hsa-miR-767-5p	CLIP-seq
MIRT1003034	hsa-miR-892a	CLIP-seq
MIRT1003035	hsa-miR-9	CLIP-seq
MIRT1003036	hsa-miR-924	CLIP-seq
MIRT1003037	hsa-miR-92a	CLIP-seq
MIRT1003038	hsa-miR-92b	CLIP-seq
MIRT1003039	hsa-miR-934	CLIP-seq
MIRT1003040	hsa-miR-940	CLIP-seq
MIRT1003041	hsa-miR-1197	CLIP-seq
MIRT1003042	hsa-miR-1207-3p	CLIP-seq
MIRT1002894	hsa-miR-1207-5p	CLIP-seq
MIRT1002895	hsa-miR-1208	CLIP-seq
MIRT1003043	hsa-miR-1233	CLIP-seq
MIRT1003044	hsa-miR-1243	CLIP-seq
MIRT1002896	hsa-miR-1270	CLIP-seq
MIRT1003045	hsa-miR-1271	CLIP-seq
MIRT1002897	hsa-miR-1278	CLIP-seq
MIRT1003046	hsa-miR-1281	CLIP-seq
MIRT1002899	hsa-miR-1283	CLIP-seq
MIRT1002900	hsa-miR-1284	CLIP-seq
MIRT1003047	hsa-miR-1299	CLIP-seq
MIRT1003048	hsa-miR-1343	CLIP-seq
MIRT1003049	hsa-miR-138	CLIP-seq
MIRT1002903	hsa-miR-139-5p	CLIP-seq
MIRT1002904	hsa-miR-153	CLIP-seq
MIRT1003050	hsa-miR-182	CLIP-seq
MIRT1003051	hsa-miR-1827	CLIP-seq
MIRT1003052	hsa-miR-185	CLIP-seq
MIRT1003053	hsa-miR-193a-5p	CLIP-seq
MIRT1002907	hsa-miR-194	CLIP-seq
MIRT1003054	hsa-miR-205	CLIP-seq
MIRT1002909	hsa-miR-221	CLIP-seq
MIRT1002910	hsa-miR-222	CLIP-seq
MIRT1003055	hsa-miR-2278	CLIP-seq
MIRT1003056	hsa-miR-2467-3p	CLIP-seq
MIRT1002911	hsa-miR-25	CLIP-seq
MIRT1002913	hsa-miR-29a	CLIP-seq
MIRT1002914	hsa-miR-29b	CLIP-seq
MIRT1002915	hsa-miR-29c	CLIP-seq
MIRT1002921	hsa-miR-3065-3p	CLIP-seq
MIRT1002922	hsa-miR-3065-5p	CLIP-seq
MIRT1002923	hsa-miR-3074-3p	CLIP-seq
MIRT1002924	hsa-miR-30a	CLIP-seq
MIRT1002925	hsa-miR-30b	CLIP-seq
MIRT1002926	hsa-miR-30c	CLIP-seq
MIRT1002927	hsa-miR-30d	CLIP-seq
MIRT1002928	hsa-miR-30e	CLIP-seq
MIRT1002929	hsa-miR-3120-3p	CLIP-seq
MIRT1003057	hsa-miR-3137	CLIP-seq
MIRT1002934	hsa-miR-3180-5p	CLIP-seq
MIRT1002935	hsa-miR-32	CLIP-seq
MIRT1002940	hsa-miR-320e	CLIP-seq
MIRT1003058	hsa-miR-335	CLIP-seq
MIRT1003059	hsa-miR-340	CLIP-seq
MIRT1002941	hsa-miR-34b	CLIP-seq
MIRT1002942	hsa-miR-34c-3p	CLIP-seq
MIRT1002943	hsa-miR-3591-3p	CLIP-seq
MIRT1002944	hsa-miR-3607-3p	CLIP-seq
MIRT1003060	hsa-miR-361-3p	CLIP-seq
MIRT1002945	hsa-miR-3617	CLIP-seq
MIRT1002946	hsa-miR-363	CLIP-seq
MIRT1003061	hsa-miR-3646	CLIP-seq
MIRT1003062	hsa-miR-3654	CLIP-seq
MIRT1002948	hsa-miR-367	CLIP-seq
MIRT1002951	hsa-miR-3686	CLIP-seq
MIRT1002956	hsa-miR-3714	CLIP-seq
MIRT1003063	hsa-miR-371-5p	CLIP-seq
MIRT1003064	hsa-miR-3918	CLIP-seq
MIRT1003065	hsa-miR-3925-3p	CLIP-seq
MIRT1003066	hsa-miR-3925-5p	CLIP-seq
MIRT1003067	hsa-miR-3935	CLIP-seq
MIRT1002962	hsa-miR-3936	CLIP-seq
MIRT1003068	hsa-miR-3942-3p	CLIP-seq
MIRT1003069	hsa-miR-3978	CLIP-seq
MIRT1002966	hsa-miR-421	CLIP-seq
MIRT1003070	hsa-miR-4254	CLIP-seq
MIRT1002967	hsa-miR-4272	CLIP-seq
MIRT1003071	hsa-miR-4284	CLIP-seq
MIRT1003072	hsa-miR-4293	CLIP-seq
MIRT1003073	hsa-miR-4306	CLIP-seq
MIRT1003074	hsa-miR-4308	CLIP-seq
MIRT1002969	hsa-miR-4318	CLIP-seq
MIRT1003075	hsa-miR-4325	CLIP-seq
MIRT1002971	hsa-miR-4420	CLIP-seq
MIRT1002972	hsa-miR-4427	CLIP-seq
MIRT1002974	hsa-miR-4433	CLIP-seq
MIRT1002975	hsa-miR-4434	CLIP-seq
MIRT1003076	hsa-miR-4436b-5p	CLIP-seq
MIRT1003077	hsa-miR-4456	CLIP-seq
MIRT1003078	hsa-miR-4468	CLIP-seq
MIRT1003079	hsa-miR-4470	CLIP-seq
MIRT1002978	hsa-miR-448	CLIP-seq
MIRT1003080	hsa-miR-4492	CLIP-seq
MIRT1003081	hsa-miR-4498	CLIP-seq
MIRT1002982	hsa-miR-4504	CLIP-seq
MIRT1003082	hsa-miR-4511	CLIP-seq
MIRT1002984	hsa-miR-4516	CLIP-seq
MIRT1003083	hsa-miR-451b	CLIP-seq
MIRT1003084	hsa-miR-4529-5p	CLIP-seq
MIRT1002985	hsa-miR-4531	CLIP-seq
MIRT1003085	hsa-miR-4644	CLIP-seq
MIRT1003086	hsa-miR-4653-3p	CLIP-seq
MIRT1003087	hsa-miR-4661-5p	CLIP-seq
MIRT1002989	hsa-miR-4663	CLIP-seq
MIRT1002990	hsa-miR-4666-5p	CLIP-seq
MIRT1003088	hsa-miR-4667-3p	CLIP-seq
MIRT1002992	hsa-miR-4680-3p	CLIP-seq
MIRT1003089	hsa-miR-4685-5p	CLIP-seq
MIRT1003090	hsa-miR-4688	CLIP-seq
MIRT1002993	hsa-miR-4693-5p	CLIP-seq
MIRT1002995	hsa-miR-4699-3p	CLIP-seq
MIRT1003091	hsa-miR-4709-5p	CLIP-seq
MIRT1003092	hsa-miR-4711-5p	CLIP-seq
MIRT1003093	hsa-miR-4721	CLIP-seq
MIRT1003094	hsa-miR-4722-5p	CLIP-seq
MIRT1003095	hsa-miR-4725-5p	CLIP-seq
MIRT1002996	hsa-miR-4727-5p	CLIP-seq
MIRT1003096	hsa-miR-4733-5p	CLIP-seq
MIRT1003097	hsa-miR-4742-3p	CLIP-seq
MIRT1003001	hsa-miR-4763-3p	CLIP-seq
MIRT1003098	hsa-miR-4768-3p	CLIP-seq
MIRT1003099	hsa-miR-4768-5p	CLIP-seq
MIRT1003100	hsa-miR-4773	CLIP-seq
MIRT1003003	hsa-miR-4778-5p	CLIP-seq
MIRT1003101	hsa-miR-4782-5p	CLIP-seq
MIRT1003102	hsa-miR-4793-3p	CLIP-seq
MIRT1003103	hsa-miR-4803	CLIP-seq
MIRT1003104	hsa-miR-486-3p	CLIP-seq
MIRT1003006	hsa-miR-495	CLIP-seq
MIRT1003105	hsa-miR-504	CLIP-seq
MIRT1003106	hsa-miR-516b	CLIP-seq
MIRT1003107	hsa-miR-524-3p	CLIP-seq
MIRT1003108	hsa-miR-525-3p	CLIP-seq
MIRT1003109	hsa-miR-541	CLIP-seq
MIRT1003021	hsa-miR-545	CLIP-seq
MIRT1003022	hsa-miR-548an	CLIP-seq
MIRT1003023	hsa-miR-548v	CLIP-seq
MIRT1003024	hsa-miR-553	CLIP-seq
MIRT1003027	hsa-miR-586	CLIP-seq
MIRT1003110	hsa-miR-596	CLIP-seq
MIRT1003111	hsa-miR-597	CLIP-seq
MIRT1003030	hsa-miR-620	CLIP-seq
MIRT1003112	hsa-miR-628-5p	CLIP-seq
MIRT1003113	hsa-miR-630	CLIP-seq
MIRT1003031	hsa-miR-641	CLIP-seq
MIRT1003114	hsa-miR-654-5p	CLIP-seq
MIRT1003115	hsa-miR-668	CLIP-seq
MIRT1003116	hsa-miR-762	CLIP-seq
MIRT1003117	hsa-miR-766	CLIP-seq
MIRT1003033	hsa-miR-767-5p	CLIP-seq
MIRT1003118	hsa-miR-875-3p	CLIP-seq
MIRT1003034	hsa-miR-892a	CLIP-seq
MIRT1003119	hsa-miR-922	CLIP-seq
MIRT1003037	hsa-miR-92a	CLIP-seq
MIRT1003038	hsa-miR-92b	CLIP-seq
MIRT1003039	hsa-miR-934	CLIP-seq
MIRT1003040	hsa-miR-940	CLIP-seq
MIRT1003120	hsa-miR-96	CLIP-seq
MIRT1922741	hsa-miR-129-5p	CLIP-seq
MIRT1997336	hsa-miR-1182	CLIP-seq
MIRT1002892	hsa-miR-1183	CLIP-seq
MIRT1002894	hsa-miR-1207-5p	CLIP-seq
MIRT1002895	hsa-miR-1208	CLIP-seq
MIRT1997337	hsa-miR-122	CLIP-seq
MIRT1997338	hsa-miR-1228	CLIP-seq
MIRT1003043	hsa-miR-1233	CLIP-seq
MIRT1997339	hsa-miR-1258	CLIP-seq
MIRT1997340	hsa-miR-125a-5p	CLIP-seq
MIRT1997341	hsa-miR-125b	CLIP-seq
MIRT1002896	hsa-miR-1270	CLIP-seq
MIRT1003045	hsa-miR-1271	CLIP-seq
MIRT1002897	hsa-miR-1278	CLIP-seq
MIRT1002898	hsa-miR-1279	CLIP-seq
MIRT1003046	hsa-miR-1281	CLIP-seq
MIRT1997342	hsa-miR-1291	CLIP-seq
MIRT1003047	hsa-miR-1299	CLIP-seq
MIRT1997343	hsa-miR-1304	CLIP-seq
MIRT1997344	hsa-miR-1307	CLIP-seq
MIRT1997345	hsa-miR-134	CLIP-seq
MIRT1003048	hsa-miR-1343	CLIP-seq
MIRT1003049	hsa-miR-138	CLIP-seq
MIRT1002904	hsa-miR-153	CLIP-seq
MIRT1997346	hsa-miR-155	CLIP-seq
MIRT1003052	hsa-miR-185	CLIP-seq
MIRT1997347	hsa-miR-190	CLIP-seq
MIRT1997348	hsa-miR-190b	CLIP-seq
MIRT1002906	hsa-miR-1915	CLIP-seq
MIRT1003053	hsa-miR-193a-5p	CLIP-seq
MIRT1002907	hsa-miR-194	CLIP-seq
MIRT1997349	hsa-miR-197	CLIP-seq
MIRT1997350	hsa-miR-2355-3p	CLIP-seq
MIRT1002911	hsa-miR-25	CLIP-seq
MIRT1002912	hsa-miR-28-3p	CLIP-seq
MIRT1002923	hsa-miR-3074-3p	CLIP-seq
MIRT1997351	hsa-miR-31	CLIP-seq
MIRT1997352	hsa-miR-3117-5p	CLIP-seq
MIRT1997353	hsa-miR-3118	CLIP-seq
MIRT1002929	hsa-miR-3120-3p	CLIP-seq
MIRT1997354	hsa-miR-3126-3p	CLIP-seq
MIRT1997355	hsa-miR-3128	CLIP-seq
MIRT1997356	hsa-miR-3136-5p	CLIP-seq
MIRT1997357	hsa-miR-3140-5p	CLIP-seq
MIRT1997358	hsa-miR-3143	CLIP-seq
MIRT1997359	hsa-miR-3146	CLIP-seq
MIRT1997360	hsa-miR-3164	CLIP-seq
MIRT1002933	hsa-miR-3168	CLIP-seq
MIRT1997361	hsa-miR-3176	CLIP-seq
MIRT1002935	hsa-miR-32	CLIP-seq
MIRT1997362	hsa-miR-326	CLIP-seq
MIRT1997363	hsa-miR-330-3p	CLIP-seq
MIRT1997364	hsa-miR-330-5p	CLIP-seq
MIRT1003058	hsa-miR-335	CLIP-seq
MIRT1997365	hsa-miR-337-5p	CLIP-seq
MIRT1003059	hsa-miR-340	CLIP-seq
MIRT1997366	hsa-miR-345	CLIP-seq
MIRT1002942	hsa-miR-34c-3p	CLIP-seq
MIRT1002943	hsa-miR-3591-3p	CLIP-seq
MIRT1002944	hsa-miR-3607-3p	CLIP-seq
MIRT1003060	hsa-miR-361-3p	CLIP-seq
MIRT1997367	hsa-miR-3620	CLIP-seq
MIRT1002946	hsa-miR-363	CLIP-seq
MIRT1003061	hsa-miR-3646	CLIP-seq
MIRT1002947	hsa-miR-3662	CLIP-seq
MIRT1997368	hsa-miR-3663-5p	CLIP-seq
MIRT1002948	hsa-miR-367	CLIP-seq
MIRT1997369	hsa-miR-3680	CLIP-seq
MIRT1002951	hsa-miR-3686	CLIP-seq
MIRT1997370	hsa-miR-3688-5p	CLIP-seq
MIRT1002956	hsa-miR-3714	CLIP-seq
MIRT1997371	hsa-miR-383	CLIP-seq
MIRT1003064	hsa-miR-3918	CLIP-seq
MIRT1997372	hsa-miR-3922-3p	CLIP-seq
MIRT1997373	hsa-miR-3924	CLIP-seq
MIRT1003065	hsa-miR-3925-3p	CLIP-seq
MIRT1003066	hsa-miR-3925-5p	CLIP-seq
MIRT1997374	hsa-miR-3926	CLIP-seq
MIRT1997375	hsa-miR-3945	CLIP-seq
MIRT1002966	hsa-miR-421	CLIP-seq
MIRT1003070	hsa-miR-4254	CLIP-seq
MIRT1997376	hsa-miR-4281	CLIP-seq
MIRT1003071	hsa-miR-4284	CLIP-seq
MIRT1002968	hsa-miR-4291	CLIP-seq
MIRT1003073	hsa-miR-4306	CLIP-seq
MIRT1003074	hsa-miR-4308	CLIP-seq
MIRT1002969	hsa-miR-4318	CLIP-seq
MIRT1997377	hsa-miR-4319	CLIP-seq
MIRT1003075	hsa-miR-4325	CLIP-seq
MIRT1002972	hsa-miR-4427	CLIP-seq
MIRT1002974	hsa-miR-4433	CLIP-seq
MIRT1002975	hsa-miR-4434	CLIP-seq
MIRT1997378	hsa-miR-4438	CLIP-seq
MIRT1997379	hsa-miR-4439	CLIP-seq
MIRT1003077	hsa-miR-4456	CLIP-seq
MIRT1002977	hsa-miR-4457	CLIP-seq
MIRT1997380	hsa-miR-4474-5p	CLIP-seq
MIRT1002978	hsa-miR-448	CLIP-seq
MIRT1003080	hsa-miR-4492	CLIP-seq
MIRT1997381	hsa-miR-4496	CLIP-seq
MIRT1003081	hsa-miR-4498	CLIP-seq
MIRT1997382	hsa-miR-4501	CLIP-seq
MIRT1002982	hsa-miR-4504	CLIP-seq
MIRT1003082	hsa-miR-4511	CLIP-seq
MIRT1997383	hsa-miR-4513	CLIP-seq
MIRT1002984	hsa-miR-4516	CLIP-seq
MIRT1003083	hsa-miR-451b	CLIP-seq
MIRT1003084	hsa-miR-4529-5p	CLIP-seq
MIRT1002985	hsa-miR-4531	CLIP-seq
MIRT1997384	hsa-miR-4638-5p	CLIP-seq
MIRT1997385	hsa-miR-4643	CLIP-seq
MIRT1003085	hsa-miR-4644	CLIP-seq
MIRT1002988	hsa-miR-4652-3p	CLIP-seq
MIRT1997386	hsa-miR-466	CLIP-seq
MIRT1997387	hsa-miR-4660	CLIP-seq
MIRT1002989	hsa-miR-4663	CLIP-seq
MIRT1002990	hsa-miR-4666-5p	CLIP-seq
MIRT1997388	hsa-miR-4667-5p	CLIP-seq
MIRT1997389	hsa-miR-4668-3p	CLIP-seq
MIRT1002992	hsa-miR-4680-3p	CLIP-seq
MIRT1003089	hsa-miR-4685-5p	CLIP-seq
MIRT1002993	hsa-miR-4693-5p	CLIP-seq
MIRT1002995	hsa-miR-4699-3p	CLIP-seq
MIRT1997390	hsa-miR-4700-5p	CLIP-seq
MIRT1003091	hsa-miR-4709-5p	CLIP-seq
MIRT1003092	hsa-miR-4711-5p	CLIP-seq
MIRT1997391	hsa-miR-4720-5p	CLIP-seq
MIRT1003095	hsa-miR-4725-5p	CLIP-seq
MIRT1997392	hsa-miR-4726-3p	CLIP-seq
MIRT1002997	hsa-miR-4731-3p	CLIP-seq
MIRT1997393	hsa-miR-4732-3p	CLIP-seq
MIRT1003096	hsa-miR-4733-5p	CLIP-seq
MIRT1997394	hsa-miR-4735-5p	CLIP-seq
MIRT1997395	hsa-miR-4743	CLIP-seq
MIRT1002999	hsa-miR-4753-3p	CLIP-seq
MIRT1003000	hsa-miR-4755-3p	CLIP-seq
MIRT1997396	hsa-miR-4757-5p	CLIP-seq
MIRT1003001	hsa-miR-4763-3p	CLIP-seq
MIRT1997397	hsa-miR-4766-5p	CLIP-seq
MIRT1003099	hsa-miR-4768-5p	CLIP-seq
MIRT1003100	hsa-miR-4773	CLIP-seq
MIRT1003002	hsa-miR-4775	CLIP-seq
MIRT1997398	hsa-miR-4781-5p	CLIP-seq
MIRT1003101	hsa-miR-4782-5p	CLIP-seq
MIRT1003004	hsa-miR-4789-3p	CLIP-seq
MIRT1003102	hsa-miR-4793-3p	CLIP-seq
MIRT1997399	hsa-miR-4799-3p	CLIP-seq
MIRT1003005	hsa-miR-4801	CLIP-seq
MIRT1003103	hsa-miR-4803	CLIP-seq
MIRT1003105	hsa-miR-504	CLIP-seq
MIRT1997400	hsa-miR-5095	CLIP-seq
MIRT1997401	hsa-miR-513a-5p	CLIP-seq
MIRT1997402	hsa-miR-514	CLIP-seq
MIRT1997403	hsa-miR-514b-3p	CLIP-seq
MIRT1003106	hsa-miR-516b	CLIP-seq
MIRT1997404	hsa-miR-518a-5p	CLIP-seq
MIRT1003017	hsa-miR-520d-5p	CLIP-seq
MIRT1003020	hsa-miR-524-5p	CLIP-seq
MIRT1997405	hsa-miR-527	CLIP-seq
MIRT1003109	hsa-miR-541	CLIP-seq
MIRT1997406	hsa-miR-542-3p	CLIP-seq
MIRT1003021	hsa-miR-545	CLIP-seq
MIRT1997407	hsa-miR-548a-3p	CLIP-seq
MIRT1997408	hsa-miR-548ag	CLIP-seq
MIRT1997409	hsa-miR-548ai	CLIP-seq
MIRT1003022	hsa-miR-548an	CLIP-seq
MIRT1997410	hsa-miR-548e	CLIP-seq
MIRT1997411	hsa-miR-548f	CLIP-seq
MIRT1997412	hsa-miR-548m	CLIP-seq
MIRT1997413	hsa-miR-548s	CLIP-seq
MIRT1003025	hsa-miR-555	CLIP-seq
MIRT1997414	hsa-miR-570	CLIP-seq
MIRT1997415	hsa-miR-574-5p	CLIP-seq
MIRT1003027	hsa-miR-586	CLIP-seq
MIRT1003029	hsa-miR-590-3p	CLIP-seq
MIRT1997416	hsa-miR-593	CLIP-seq
MIRT1003111	hsa-miR-597	CLIP-seq
MIRT1997417	hsa-miR-603	CLIP-seq
MIRT1003030	hsa-miR-620	CLIP-seq
MIRT1997418	hsa-miR-637	CLIP-seq
MIRT1997419	hsa-miR-644	CLIP-seq
MIRT1997420	hsa-miR-646	CLIP-seq
MIRT1003114	hsa-miR-654-5p	CLIP-seq
MIRT1997421	hsa-miR-676	CLIP-seq
MIRT1997422	hsa-miR-744	CLIP-seq
MIRT1003116	hsa-miR-762	CLIP-seq
MIRT1003117	hsa-miR-766	CLIP-seq
MIRT1003034	hsa-miR-892a	CLIP-seq
MIRT1003119	hsa-miR-922	CLIP-seq
MIRT1003037	hsa-miR-92a	CLIP-seq
MIRT1003038	hsa-miR-92b	CLIP-seq
MIRT1003040	hsa-miR-940	CLIP-seq
MIRT1003120	hsa-miR-96	CLIP-seq
MIRT1997337	hsa-miR-122	CLIP-seq
MIRT1003047	hsa-miR-1299	CLIP-seq
MIRT1997346	hsa-miR-155	CLIP-seq
MIRT1002989	hsa-miR-4663	CLIP-seq
MIRT1003099	hsa-miR-4768-5p	CLIP-seq
MIRT1003101	hsa-miR-4782-5p	CLIP-seq
MIRT1003106	hsa-miR-516b	CLIP-seq
MIRT1997336	hsa-miR-1182	CLIP-seq
MIRT1002892	hsa-miR-1183	CLIP-seq
MIRT1002895	hsa-miR-1208	CLIP-seq
MIRT1997337	hsa-miR-122	CLIP-seq
MIRT2231049	hsa-miR-1244	CLIP-seq
MIRT1997339	hsa-miR-1258	CLIP-seq
MIRT2231050	hsa-miR-1262	CLIP-seq
MIRT2231051	hsa-miR-1266	CLIP-seq
MIRT1002896	hsa-miR-1270	CLIP-seq
MIRT1003045	hsa-miR-1271	CLIP-seq
MIRT1002897	hsa-miR-1278	CLIP-seq
MIRT1003046	hsa-miR-1281	CLIP-seq
MIRT1002900	hsa-miR-1284	CLIP-seq
MIRT1002901	hsa-miR-1293	CLIP-seq
MIRT1003047	hsa-miR-1299	CLIP-seq
MIRT1997343	hsa-miR-1304	CLIP-seq
MIRT1997344	hsa-miR-1307	CLIP-seq
MIRT1002904	hsa-miR-153	CLIP-seq
MIRT1997346	hsa-miR-155	CLIP-seq
MIRT1003050	hsa-miR-182	CLIP-seq
MIRT2231052	hsa-miR-186	CLIP-seq
MIRT1997347	hsa-miR-190	CLIP-seq
MIRT2231053	hsa-miR-1909	CLIP-seq
MIRT1997348	hsa-miR-190b	CLIP-seq
MIRT1002908	hsa-miR-2116	CLIP-seq
MIRT2231054	hsa-miR-22	CLIP-seq
MIRT1003055	hsa-miR-2278	CLIP-seq
MIRT2231055	hsa-miR-2467-5p	CLIP-seq
MIRT1002913	hsa-miR-29a	CLIP-seq
MIRT1002914	hsa-miR-29b	CLIP-seq
MIRT1002915	hsa-miR-29c	CLIP-seq
MIRT1002921	hsa-miR-3065-3p	CLIP-seq
MIRT1997351	hsa-miR-31	CLIP-seq
MIRT1002929	hsa-miR-3120-3p	CLIP-seq
MIRT1002930	hsa-miR-3124-3p	CLIP-seq
MIRT2231056	hsa-miR-3133	CLIP-seq
MIRT2231057	hsa-miR-3135b	CLIP-seq
MIRT1997356	hsa-miR-3136-5p	CLIP-seq
MIRT1997357	hsa-miR-3140-5p	CLIP-seq
MIRT1997359	hsa-miR-3146	CLIP-seq
MIRT2231058	hsa-miR-3149	CLIP-seq
MIRT2231059	hsa-miR-3163	CLIP-seq
MIRT1002933	hsa-miR-3168	CLIP-seq
MIRT1997361	hsa-miR-3176	CLIP-seq
MIRT1002934	hsa-miR-3180-5p	CLIP-seq
MIRT2231060	hsa-miR-3188	CLIP-seq
MIRT2231061	hsa-miR-325	CLIP-seq
MIRT1997365	hsa-miR-337-5p	CLIP-seq
MIRT1003059	hsa-miR-340	CLIP-seq
MIRT1002942	hsa-miR-34c-3p	CLIP-seq
MIRT1002943	hsa-miR-3591-3p	CLIP-seq
MIRT1997368	hsa-miR-3663-5p	CLIP-seq
MIRT2231062	hsa-miR-3664-3p	CLIP-seq
MIRT2231063	hsa-miR-3664-5p	CLIP-seq
MIRT2231064	hsa-miR-3668	CLIP-seq
MIRT1997370	hsa-miR-3688-5p	CLIP-seq
MIRT2231065	hsa-miR-3921	CLIP-seq
MIRT1997372	hsa-miR-3922-3p	CLIP-seq
MIRT1997374	hsa-miR-3926	CLIP-seq
MIRT1003067	hsa-miR-3935	CLIP-seq
MIRT1002962	hsa-miR-3936	CLIP-seq
MIRT2231066	hsa-miR-3944-5p	CLIP-seq
MIRT2231067	hsa-miR-3975	CLIP-seq
MIRT1003069	hsa-miR-3978	CLIP-seq
MIRT1003071	hsa-miR-4284	CLIP-seq
MIRT1003072	hsa-miR-4293	CLIP-seq
MIRT1003075	hsa-miR-4325	CLIP-seq
MIRT1002971	hsa-miR-4420	CLIP-seq
MIRT1002972	hsa-miR-4427	CLIP-seq
MIRT1002976	hsa-miR-4436a	CLIP-seq
MIRT1003076	hsa-miR-4436b-5p	CLIP-seq
MIRT1997378	hsa-miR-4438	CLIP-seq
MIRT1997379	hsa-miR-4439	CLIP-seq
MIRT1003077	hsa-miR-4456	CLIP-seq
MIRT1002977	hsa-miR-4457	CLIP-seq
MIRT1003078	hsa-miR-4468	CLIP-seq
MIRT1003079	hsa-miR-4470	CLIP-seq
MIRT1002978	hsa-miR-448	CLIP-seq
MIRT1002980	hsa-miR-4483	CLIP-seq
MIRT1002982	hsa-miR-4504	CLIP-seq
MIRT1003082	hsa-miR-4511	CLIP-seq
MIRT2231068	hsa-miR-4518	CLIP-seq
MIRT2231069	hsa-miR-4528	CLIP-seq
MIRT1002985	hsa-miR-4531	CLIP-seq
MIRT2231070	hsa-miR-4539	CLIP-seq
MIRT1997384	hsa-miR-4638-5p	CLIP-seq
MIRT2231071	hsa-miR-4641	CLIP-seq
MIRT2231072	hsa-miR-4653-5p	CLIP-seq
MIRT1003087	hsa-miR-4661-5p	CLIP-seq
MIRT1002989	hsa-miR-4663	CLIP-seq
MIRT1002990	hsa-miR-4666-5p	CLIP-seq
MIRT1002992	hsa-miR-4680-3p	CLIP-seq
MIRT2231073	hsa-miR-4680-5p	CLIP-seq
MIRT2231074	hsa-miR-4695-3p	CLIP-seq
MIRT1002995	hsa-miR-4699-3p	CLIP-seq
MIRT2231075	hsa-miR-4699-5p	CLIP-seq
MIRT2231076	hsa-miR-4701-3p	CLIP-seq
MIRT2231077	hsa-miR-4707-5p	CLIP-seq
MIRT2231078	hsa-miR-4714-5p	CLIP-seq
MIRT1997391	hsa-miR-4720-5p	CLIP-seq
MIRT1002997	hsa-miR-4731-3p	CLIP-seq
MIRT1997394	hsa-miR-4735-5p	CLIP-seq
MIRT1003097	hsa-miR-4742-3p	CLIP-seq
MIRT1997395	hsa-miR-4743	CLIP-seq
MIRT2231079	hsa-miR-4744	CLIP-seq
MIRT2231080	hsa-miR-4753-5p	CLIP-seq
MIRT1003000	hsa-miR-4755-3p	CLIP-seq
MIRT2231081	hsa-miR-4760-3p	CLIP-seq
MIRT1997397	hsa-miR-4766-5p	CLIP-seq
MIRT1003099	hsa-miR-4768-5p	CLIP-seq
MIRT1003002	hsa-miR-4775	CLIP-seq
MIRT2231082	hsa-miR-4780	CLIP-seq
MIRT1003101	hsa-miR-4782-5p	CLIP-seq
MIRT1003004	hsa-miR-4789-3p	CLIP-seq
MIRT1003102	hsa-miR-4793-3p	CLIP-seq
MIRT1997399	hsa-miR-4799-3p	CLIP-seq
MIRT1003005	hsa-miR-4801	CLIP-seq
MIRT2231083	hsa-miR-4802-5p	CLIP-seq
MIRT1003103	hsa-miR-4803	CLIP-seq
MIRT2231084	hsa-miR-485-5p	CLIP-seq
MIRT2231085	hsa-miR-494	CLIP-seq
MIRT1997400	hsa-miR-5095	CLIP-seq
MIRT1997401	hsa-miR-513a-5p	CLIP-seq
MIRT1997402	hsa-miR-514	CLIP-seq
MIRT1997403	hsa-miR-514b-3p	CLIP-seq
MIRT1003106	hsa-miR-516b	CLIP-seq
MIRT2231086	hsa-miR-548aa	CLIP-seq
MIRT1997413	hsa-miR-548s	CLIP-seq
MIRT1003025	hsa-miR-555	CLIP-seq
MIRT2231087	hsa-miR-562	CLIP-seq
MIRT2231088	hsa-miR-564	CLIP-seq
MIRT1997414	hsa-miR-570	CLIP-seq
MIRT1997415	hsa-miR-574-5p	CLIP-seq
MIRT2231089	hsa-miR-579	CLIP-seq
MIRT1003029	hsa-miR-590-3p	CLIP-seq
MIRT1997416	hsa-miR-593	CLIP-seq
MIRT1003110	hsa-miR-596	CLIP-seq
MIRT1003111	hsa-miR-597	CLIP-seq
MIRT1997417	hsa-miR-603	CLIP-seq
MIRT1003030	hsa-miR-620	CLIP-seq
MIRT2231090	hsa-miR-628-3p	CLIP-seq
MIRT1003112	hsa-miR-628-5p	CLIP-seq
MIRT1003113	hsa-miR-630	CLIP-seq
MIRT1003032	hsa-miR-642b	CLIP-seq
MIRT1997419	hsa-miR-644	CLIP-seq
MIRT1003115	hsa-miR-668	CLIP-seq
MIRT1003033	hsa-miR-767-5p	CLIP-seq
MIRT1003040	hsa-miR-940	CLIP-seq
MIRT1003120	hsa-miR-96	CLIP-seq
MIRT1002895	hsa-miR-1208	CLIP-seq
MIRT1997337	hsa-miR-122	CLIP-seq
MIRT1002896	hsa-miR-1270	CLIP-seq
MIRT1003045	hsa-miR-1271	CLIP-seq
MIRT1003047	hsa-miR-1299	CLIP-seq
MIRT1002921	hsa-miR-3065-3p	CLIP-seq
MIRT1002929	hsa-miR-3120-3p	CLIP-seq
MIRT1997359	hsa-miR-3146	CLIP-seq
MIRT1003059	hsa-miR-340	CLIP-seq
MIRT1002944	hsa-miR-3607-3p	CLIP-seq
MIRT1002977	hsa-miR-4457	CLIP-seq
MIRT1997381	hsa-miR-4496	CLIP-seq
MIRT1002982	hsa-miR-4504	CLIP-seq
MIRT1002985	hsa-miR-4531	CLIP-seq
MIRT1002989	hsa-miR-4663	CLIP-seq
MIRT2231074	hsa-miR-4695-3p	CLIP-seq
MIRT1003000	hsa-miR-4755-3p	CLIP-seq
MIRT1003099	hsa-miR-4768-5p	CLIP-seq
MIRT1003101	hsa-miR-4782-5p	CLIP-seq
MIRT1003106	hsa-miR-516b	CLIP-seq
MIRT1997416	hsa-miR-593	CLIP-seq
MIRT1003030	hsa-miR-620	CLIP-seq
MIRT1003040	hsa-miR-940	CLIP-seq
MIRT1003120	hsa-miR-96	CLIP-seq
MIRT1002894	hsa-miR-1207-5p	CLIP-seq
MIRT1997337	hsa-miR-122	CLIP-seq
MIRT1003047	hsa-miR-1299	CLIP-seq
MIRT1002903	hsa-miR-139-5p	CLIP-seq
MIRT1003052	hsa-miR-185	CLIP-seq
MIRT1002908	hsa-miR-2116	CLIP-seq
MIRT1002909	hsa-miR-221	CLIP-seq
MIRT1002910	hsa-miR-222	CLIP-seq
MIRT1002911	hsa-miR-25	CLIP-seq
MIRT1002913	hsa-miR-29a	CLIP-seq
MIRT1002914	hsa-miR-29b	CLIP-seq
MIRT1002915	hsa-miR-29c	CLIP-seq
MIRT1002916	hsa-miR-302a	CLIP-seq
MIRT1002917	hsa-miR-302b	CLIP-seq
MIRT1002918	hsa-miR-302c	CLIP-seq
MIRT1002919	hsa-miR-302d	CLIP-seq
MIRT1002920	hsa-miR-302e	CLIP-seq
MIRT1002921	hsa-miR-3065-3p	CLIP-seq
MIRT1997351	hsa-miR-31	CLIP-seq
MIRT1002929	hsa-miR-3120-3p	CLIP-seq
MIRT1002930	hsa-miR-3124-3p	CLIP-seq
MIRT2231057	hsa-miR-3135b	CLIP-seq
MIRT2231059	hsa-miR-3163	CLIP-seq
MIRT1002933	hsa-miR-3168	CLIP-seq
MIRT1002934	hsa-miR-3180-5p	CLIP-seq
MIRT1002935	hsa-miR-32	CLIP-seq
MIRT1002942	hsa-miR-34c-3p	CLIP-seq
MIRT2388160	hsa-miR-3622b-5p	CLIP-seq
MIRT1002946	hsa-miR-363	CLIP-seq
MIRT2388161	hsa-miR-3652	CLIP-seq
MIRT1002947	hsa-miR-3662	CLIP-seq
MIRT1002948	hsa-miR-367	CLIP-seq
MIRT1997370	hsa-miR-3688-5p	CLIP-seq
MIRT1002956	hsa-miR-3714	CLIP-seq
MIRT1002957	hsa-miR-372	CLIP-seq
MIRT1002958	hsa-miR-373	CLIP-seq
MIRT1003064	hsa-miR-3918	CLIP-seq
MIRT1002964	hsa-miR-3977	CLIP-seq
MIRT1002965	hsa-miR-412	CLIP-seq
MIRT1003071	hsa-miR-4284	CLIP-seq
MIRT1003073	hsa-miR-4306	CLIP-seq
MIRT2388162	hsa-miR-4430	CLIP-seq
MIRT1003077	hsa-miR-4456	CLIP-seq
MIRT1002977	hsa-miR-4457	CLIP-seq
MIRT1002978	hsa-miR-448	CLIP-seq
MIRT1003083	hsa-miR-451b	CLIP-seq
MIRT1003084	hsa-miR-4529-5p	CLIP-seq
MIRT1003085	hsa-miR-4644	CLIP-seq
MIRT1002989	hsa-miR-4663	CLIP-seq
MIRT1002990	hsa-miR-4666-5p	CLIP-seq
MIRT2231073	hsa-miR-4680-5p	CLIP-seq
MIRT2388163	hsa-miR-4694-3p	CLIP-seq
MIRT2231074	hsa-miR-4695-3p	CLIP-seq
MIRT1002995	hsa-miR-4699-3p	CLIP-seq
MIRT1997391	hsa-miR-4720-5p	CLIP-seq
MIRT1003001	hsa-miR-4763-3p	CLIP-seq
MIRT1003101	hsa-miR-4782-5p	CLIP-seq
MIRT1003004	hsa-miR-4789-3p	CLIP-seq
MIRT1997399	hsa-miR-4799-3p	CLIP-seq
MIRT1003106	hsa-miR-516b	CLIP-seq
MIRT1003010	hsa-miR-519a	CLIP-seq
MIRT1003011	hsa-miR-519b-3p	CLIP-seq
MIRT1003012	hsa-miR-519c-3p	CLIP-seq
MIRT1003013	hsa-miR-520a-3p	CLIP-seq
MIRT1003014	hsa-miR-520b	CLIP-seq
MIRT1003015	hsa-miR-520c-3p	CLIP-seq
MIRT1003016	hsa-miR-520d-3p	CLIP-seq
MIRT1003018	hsa-miR-520e	CLIP-seq
MIRT1003019	hsa-miR-520f	CLIP-seq
MIRT1003107	hsa-miR-524-3p	CLIP-seq
MIRT1003108	hsa-miR-525-3p	CLIP-seq
MIRT1003021	hsa-miR-545	CLIP-seq
MIRT1003022	hsa-miR-548an	CLIP-seq
MIRT2388164	hsa-miR-548g	CLIP-seq
MIRT1003023	hsa-miR-548v	CLIP-seq
MIRT1003025	hsa-miR-555	CLIP-seq
MIRT1997415	hsa-miR-574-5p	CLIP-seq
MIRT1003032	hsa-miR-642b	CLIP-seq
MIRT1997419	hsa-miR-644	CLIP-seq
MIRT1003033	hsa-miR-767-5p	CLIP-seq
MIRT1003037	hsa-miR-92a	CLIP-seq
MIRT1003038	hsa-miR-92b	CLIP-seq
MIRT1003039	hsa-miR-934	CLIP-seq
MIRT1003040	hsa-miR-940	CLIP-seq
MIRT2231051	hsa-miR-1266	CLIP-seq
MIRT1003047	hsa-miR-1299	CLIP-seq
MIRT1002929	hsa-miR-3120-3p	CLIP-seq
MIRT1002931	hsa-miR-3125	CLIP-seq
MIRT1002961	hsa-miR-3916	CLIP-seq
MIRT2231068	hsa-miR-4518	CLIP-seq
MIRT1003099	hsa-miR-4768-5p	CLIP-seq
MIRT1003118	hsa-miR-875-3p	CLIP-seq
MIRT1003044	hsa-miR-1243	CLIP-seq
MIRT1002904	hsa-miR-153	CLIP-seq
MIRT1002929	hsa-miR-3120-3p	CLIP-seq
MIRT2437307	hsa-miR-323-3p	CLIP-seq
MIRT1003062	hsa-miR-3654	CLIP-seq
MIRT1003069	hsa-miR-3978	CLIP-seq
MIRT1002978	hsa-miR-448	CLIP-seq
MIRT1003118	hsa-miR-875-3p	CLIP-seq
MIRT2534956	hsa-miR-100	CLIP-seq
MIRT2534957	hsa-miR-10a	CLIP-seq
MIRT2534958	hsa-miR-10b	CLIP-seq
MIRT1002892	hsa-miR-1183	CLIP-seq
MIRT2534959	hsa-miR-1200	CLIP-seq
MIRT1002894	hsa-miR-1207-5p	CLIP-seq
MIRT1997337	hsa-miR-122	CLIP-seq
MIRT2534960	hsa-miR-1227	CLIP-seq
MIRT2231049	hsa-miR-1244	CLIP-seq
MIRT2534961	hsa-miR-1247	CLIP-seq
MIRT2534962	hsa-miR-126	CLIP-seq
MIRT1003045	hsa-miR-1271	CLIP-seq
MIRT1002897	hsa-miR-1278	CLIP-seq
MIRT1002898	hsa-miR-1279	CLIP-seq
MIRT1003046	hsa-miR-1281	CLIP-seq
MIRT2534963	hsa-miR-1298	CLIP-seq
MIRT1003047	hsa-miR-1299	CLIP-seq
MIRT1997344	hsa-miR-1307	CLIP-seq
MIRT1003048	hsa-miR-1343	CLIP-seq
MIRT1003049	hsa-miR-138	CLIP-seq
MIRT1002904	hsa-miR-153	CLIP-seq
MIRT1003050	hsa-miR-182	CLIP-seq
MIRT2534964	hsa-miR-184	CLIP-seq
MIRT1003052	hsa-miR-185	CLIP-seq
MIRT1002905	hsa-miR-1912	CLIP-seq
MIRT1003053	hsa-miR-193a-5p	CLIP-seq
MIRT1997349	hsa-miR-197	CLIP-seq
MIRT1003054	hsa-miR-205	CLIP-seq
MIRT1002908	hsa-miR-2116	CLIP-seq
MIRT2534965	hsa-miR-23a	CLIP-seq
MIRT2534966	hsa-miR-23b	CLIP-seq
MIRT2534967	hsa-miR-23c	CLIP-seq
MIRT1003056	hsa-miR-2467-3p	CLIP-seq
MIRT1002911	hsa-miR-25	CLIP-seq
MIRT2534968	hsa-miR-28-5p	CLIP-seq
MIRT2534969	hsa-miR-296-5p	CLIP-seq
MIRT2534970	hsa-miR-3074-5p	CLIP-seq
MIRT1997351	hsa-miR-31	CLIP-seq
MIRT1002930	hsa-miR-3124-3p	CLIP-seq
MIRT1002931	hsa-miR-3125	CLIP-seq
MIRT1997354	hsa-miR-3126-3p	CLIP-seq
MIRT1997355	hsa-miR-3128	CLIP-seq
MIRT2534971	hsa-miR-3129-3p	CLIP-seq
MIRT1002932	hsa-miR-3130-5p	CLIP-seq
MIRT2231057	hsa-miR-3135b	CLIP-seq
MIRT2534972	hsa-miR-3139	CLIP-seq
MIRT1997357	hsa-miR-3140-5p	CLIP-seq
MIRT1997359	hsa-miR-3146	CLIP-seq
MIRT2231058	hsa-miR-3149	CLIP-seq
MIRT2534973	hsa-miR-3152-5p	CLIP-seq
MIRT2534974	hsa-miR-3160-3p	CLIP-seq
MIRT2231059	hsa-miR-3163	CLIP-seq
MIRT1002933	hsa-miR-3168	CLIP-seq
MIRT2534975	hsa-miR-3177-3p	CLIP-seq
MIRT1002935	hsa-miR-32	CLIP-seq
MIRT2231061	hsa-miR-325	CLIP-seq
MIRT2534976	hsa-miR-331-3p	CLIP-seq
MIRT2534977	hsa-miR-33a	CLIP-seq
MIRT2534978	hsa-miR-33b	CLIP-seq
MIRT1003059	hsa-miR-340	CLIP-seq
MIRT1997366	hsa-miR-345	CLIP-seq
MIRT2534979	hsa-miR-3607-5p	CLIP-seq
MIRT2534980	hsa-miR-3611	CLIP-seq
MIRT2534981	hsa-miR-3613-3p	CLIP-seq
MIRT1003060	hsa-miR-361-3p	CLIP-seq
MIRT1997367	hsa-miR-3620	CLIP-seq
MIRT2388160	hsa-miR-3622b-5p	CLIP-seq
MIRT1002946	hsa-miR-363	CLIP-seq
MIRT2534982	hsa-miR-3647-3p	CLIP-seq
MIRT2534983	hsa-miR-3650	CLIP-seq
MIRT2388161	hsa-miR-3652	CLIP-seq
MIRT1002947	hsa-miR-3662	CLIP-seq
MIRT1997368	hsa-miR-3663-5p	CLIP-seq
MIRT2231063	hsa-miR-3664-5p	CLIP-seq
MIRT1002948	hsa-miR-367	CLIP-seq
MIRT2534984	hsa-miR-3678-3p	CLIP-seq
MIRT1997370	hsa-miR-3688-5p	CLIP-seq
MIRT2534985	hsa-miR-3690	CLIP-seq
MIRT1002960	hsa-miR-3907	CLIP-seq
MIRT1002961	hsa-miR-3916	CLIP-seq
MIRT2231065	hsa-miR-3921	CLIP-seq
MIRT1003065	hsa-miR-3925-3p	CLIP-seq
MIRT2534986	hsa-miR-3937	CLIP-seq
MIRT2534987	hsa-miR-3942-5p	CLIP-seq
MIRT2231067	hsa-miR-3975	CLIP-seq
MIRT2534988	hsa-miR-4251	CLIP-seq
MIRT1003070	hsa-miR-4254	CLIP-seq
MIRT2534989	hsa-miR-4261	CLIP-seq
MIRT1997376	hsa-miR-4281	CLIP-seq
MIRT2534990	hsa-miR-4282	CLIP-seq
MIRT1003071	hsa-miR-4284	CLIP-seq
MIRT1002968	hsa-miR-4291	CLIP-seq
MIRT1003072	hsa-miR-4293	CLIP-seq
MIRT2534991	hsa-miR-4299	CLIP-seq
MIRT1003073	hsa-miR-4306	CLIP-seq
MIRT1003075	hsa-miR-4325	CLIP-seq
MIRT2534992	hsa-miR-4329	CLIP-seq
MIRT2534993	hsa-miR-4330	CLIP-seq
MIRT1002972	hsa-miR-4427	CLIP-seq
MIRT2388162	hsa-miR-4430	CLIP-seq
MIRT1002974	hsa-miR-4433	CLIP-seq
MIRT1997378	hsa-miR-4438	CLIP-seq
MIRT1003077	hsa-miR-4456	CLIP-seq
MIRT1002977	hsa-miR-4457	CLIP-seq
MIRT1002978	hsa-miR-448	CLIP-seq
MIRT2534994	hsa-miR-4481	CLIP-seq
MIRT1002979	hsa-miR-4482	CLIP-seq
MIRT2534995	hsa-miR-4487	CLIP-seq
MIRT1003080	hsa-miR-4492	CLIP-seq
MIRT1997381	hsa-miR-4496	CLIP-seq
MIRT1003081	hsa-miR-4498	CLIP-seq
MIRT1002982	hsa-miR-4504	CLIP-seq
MIRT1003082	hsa-miR-4511	CLIP-seq
MIRT1003083	hsa-miR-451b	CLIP-seq
MIRT2231069	hsa-miR-4528	CLIP-seq
MIRT1997384	hsa-miR-4638-5p	CLIP-seq
MIRT2231071	hsa-miR-4641	CLIP-seq
MIRT1003085	hsa-miR-4644	CLIP-seq
MIRT1003086	hsa-miR-4653-3p	CLIP-seq
MIRT2231072	hsa-miR-4653-5p	CLIP-seq
MIRT1003087	hsa-miR-4661-5p	CLIP-seq
MIRT1002989	hsa-miR-4663	CLIP-seq
MIRT1002990	hsa-miR-4666-5p	CLIP-seq
MIRT2534996	hsa-miR-4679	CLIP-seq
MIRT1002992	hsa-miR-4680-3p	CLIP-seq
MIRT2231073	hsa-miR-4680-5p	CLIP-seq
MIRT1003089	hsa-miR-4685-5p	CLIP-seq
MIRT2388163	hsa-miR-4694-3p	CLIP-seq
MIRT2231074	hsa-miR-4695-3p	CLIP-seq
MIRT2534997	hsa-miR-4698	CLIP-seq
MIRT2231075	hsa-miR-4699-5p	CLIP-seq
MIRT2534998	hsa-miR-4703-5p	CLIP-seq
MIRT2231077	hsa-miR-4707-5p	CLIP-seq
MIRT1003092	hsa-miR-4711-5p	CLIP-seq
MIRT2231078	hsa-miR-4714-5p	CLIP-seq
MIRT1997391	hsa-miR-4720-5p	CLIP-seq
MIRT1003095	hsa-miR-4725-5p	CLIP-seq
MIRT2534999	hsa-miR-4729	CLIP-seq
MIRT2535000	hsa-miR-4731-5p	CLIP-seq
MIRT1997393	hsa-miR-4732-3p	CLIP-seq
MIRT1997394	hsa-miR-4735-5p	CLIP-seq
MIRT2535001	hsa-miR-4736	CLIP-seq
MIRT1003097	hsa-miR-4742-3p	CLIP-seq
MIRT1997395	hsa-miR-4743	CLIP-seq
MIRT2535002	hsa-miR-4745-5p	CLIP-seq
MIRT2231080	hsa-miR-4753-5p	CLIP-seq
MIRT1003000	hsa-miR-4755-3p	CLIP-seq
MIRT2535003	hsa-miR-4758-5p	CLIP-seq
MIRT2535004	hsa-miR-4760-5p	CLIP-seq
MIRT1003001	hsa-miR-4763-3p	CLIP-seq
MIRT2535005	hsa-miR-4774-3p	CLIP-seq
MIRT1003002	hsa-miR-4775	CLIP-seq
MIRT1003101	hsa-miR-4782-5p	CLIP-seq
MIRT2535006	hsa-miR-4787-3p	CLIP-seq
MIRT1003004	hsa-miR-4789-3p	CLIP-seq
MIRT1003102	hsa-miR-4793-3p	CLIP-seq
MIRT1997399	hsa-miR-4799-3p	CLIP-seq
MIRT2535007	hsa-miR-4802-3p	CLIP-seq
MIRT2231083	hsa-miR-4802-5p	CLIP-seq
MIRT2535008	hsa-miR-4804-5p	CLIP-seq
MIRT2535009	hsa-miR-483-3p	CLIP-seq
MIRT2535010	hsa-miR-486-5p	CLIP-seq
MIRT2535011	hsa-miR-501-3p	CLIP-seq
MIRT2535012	hsa-miR-502-3p	CLIP-seq
MIRT1003105	hsa-miR-504	CLIP-seq
MIRT1997400	hsa-miR-5095	CLIP-seq
MIRT1997401	hsa-miR-513a-5p	CLIP-seq
MIRT1003106	hsa-miR-516b	CLIP-seq
MIRT1003107	hsa-miR-524-3p	CLIP-seq
MIRT1003108	hsa-miR-525-3p	CLIP-seq
MIRT1003109	hsa-miR-541	CLIP-seq
MIRT1003021	hsa-miR-545	CLIP-seq
MIRT2388164	hsa-miR-548g	CLIP-seq
MIRT2535013	hsa-miR-548p	CLIP-seq
MIRT2535014	hsa-miR-558	CLIP-seq
MIRT1997415	hsa-miR-574-5p	CLIP-seq
MIRT2535015	hsa-miR-577	CLIP-seq
MIRT2231089	hsa-miR-579	CLIP-seq
MIRT1003028	hsa-miR-587	CLIP-seq
MIRT1003029	hsa-miR-590-3p	CLIP-seq
MIRT1997416	hsa-miR-593	CLIP-seq
MIRT1003110	hsa-miR-596	CLIP-seq
MIRT1997417	hsa-miR-603	CLIP-seq
MIRT2535016	hsa-miR-615-5p	CLIP-seq
MIRT2535017	hsa-miR-624	CLIP-seq
MIRT2231090	hsa-miR-628-3p	CLIP-seq
MIRT1003113	hsa-miR-630	CLIP-seq
MIRT1003032	hsa-miR-642b	CLIP-seq
MIRT1997419	hsa-miR-644	CLIP-seq
MIRT1003114	hsa-miR-654-5p	CLIP-seq
MIRT2535018	hsa-miR-664	CLIP-seq
MIRT2535019	hsa-miR-708	CLIP-seq
MIRT1003116	hsa-miR-762	CLIP-seq
MIRT2535020	hsa-miR-765	CLIP-seq
MIRT1003117	hsa-miR-766	CLIP-seq
MIRT2535021	hsa-miR-891b	CLIP-seq
MIRT1003037	hsa-miR-92a	CLIP-seq
MIRT1003038	hsa-miR-92b	CLIP-seq
MIRT1003120	hsa-miR-96	CLIP-seq
MIRT2535022	hsa-miR-99a	CLIP-seq
MIRT2535023	hsa-miR-99b	CLIP-seq
MIRT1002892	hsa-miR-1183	CLIP-seq
MIRT1997337	hsa-miR-122	CLIP-seq
MIRT1002931	hsa-miR-3125	CLIP-seq
MIRT1002961	hsa-miR-3916	CLIP-seq
MIRT2231089	hsa-miR-579	CLIP-seq
MIRT2534956	hsa-miR-100	CLIP-seq
MIRT2534957	hsa-miR-10a	CLIP-seq
MIRT2534958	hsa-miR-10b	CLIP-seq
MIRT1002892	hsa-miR-1183	CLIP-seq
MIRT2534959	hsa-miR-1200	CLIP-seq
MIRT1997337	hsa-miR-122	CLIP-seq
MIRT2534960	hsa-miR-1227	CLIP-seq
MIRT2231049	hsa-miR-1244	CLIP-seq
MIRT2534961	hsa-miR-1247	CLIP-seq
MIRT2534962	hsa-miR-126	CLIP-seq
MIRT1003045	hsa-miR-1271	CLIP-seq
MIRT1002897	hsa-miR-1278	CLIP-seq
MIRT1002898	hsa-miR-1279	CLIP-seq
MIRT1003046	hsa-miR-1281	CLIP-seq
MIRT2534963	hsa-miR-1298	CLIP-seq
MIRT1003047	hsa-miR-1299	CLIP-seq
MIRT1997344	hsa-miR-1307	CLIP-seq
MIRT1003048	hsa-miR-1343	CLIP-seq
MIRT1003049	hsa-miR-138	CLIP-seq
MIRT1003050	hsa-miR-182	CLIP-seq
MIRT2534964	hsa-miR-184	CLIP-seq
MIRT1003052	hsa-miR-185	CLIP-seq
MIRT1002905	hsa-miR-1912	CLIP-seq
MIRT1003053	hsa-miR-193a-5p	CLIP-seq
MIRT1997349	hsa-miR-197	CLIP-seq
MIRT1002908	hsa-miR-2116	CLIP-seq
MIRT1003056	hsa-miR-2467-3p	CLIP-seq
MIRT1002911	hsa-miR-25	CLIP-seq
MIRT2534968	hsa-miR-28-5p	CLIP-seq
MIRT2534970	hsa-miR-3074-5p	CLIP-seq
MIRT1997351	hsa-miR-31	CLIP-seq
MIRT1002930	hsa-miR-3124-3p	CLIP-seq
MIRT1002931	hsa-miR-3125	CLIP-seq
MIRT1997354	hsa-miR-3126-3p	CLIP-seq
MIRT1997355	hsa-miR-3128	CLIP-seq
MIRT1002932	hsa-miR-3130-5p	CLIP-seq
MIRT2231057	hsa-miR-3135b	CLIP-seq
MIRT2534972	hsa-miR-3139	CLIP-seq
MIRT1997357	hsa-miR-3140-5p	CLIP-seq
MIRT1997359	hsa-miR-3146	CLIP-seq
MIRT2231058	hsa-miR-3149	CLIP-seq
MIRT2534973	hsa-miR-3152-5p	CLIP-seq
MIRT2534974	hsa-miR-3160-3p	CLIP-seq
MIRT2231059	hsa-miR-3163	CLIP-seq
MIRT1002933	hsa-miR-3168	CLIP-seq
MIRT2534975	hsa-miR-3177-3p	CLIP-seq
MIRT1002935	hsa-miR-32	CLIP-seq
MIRT2231061	hsa-miR-325	CLIP-seq
MIRT2534977	hsa-miR-33a	CLIP-seq
MIRT2534978	hsa-miR-33b	CLIP-seq
MIRT1003059	hsa-miR-340	CLIP-seq
MIRT1997366	hsa-miR-345	CLIP-seq
MIRT2534981	hsa-miR-3613-3p	CLIP-seq
MIRT1003060	hsa-miR-361-3p	CLIP-seq
MIRT1997367	hsa-miR-3620	CLIP-seq
MIRT2388160	hsa-miR-3622b-5p	CLIP-seq
MIRT1002946	hsa-miR-363	CLIP-seq
MIRT2534982	hsa-miR-3647-3p	CLIP-seq
MIRT2388161	hsa-miR-3652	CLIP-seq
MIRT1002947	hsa-miR-3662	CLIP-seq
MIRT1997368	hsa-miR-3663-5p	CLIP-seq
MIRT2231063	hsa-miR-3664-5p	CLIP-seq
MIRT2231064	hsa-miR-3668	CLIP-seq
MIRT1002948	hsa-miR-367	CLIP-seq
MIRT2534984	hsa-miR-3678-3p	CLIP-seq
MIRT1997370	hsa-miR-3688-5p	CLIP-seq
MIRT2534985	hsa-miR-3690	CLIP-seq
MIRT1002960	hsa-miR-3907	CLIP-seq
MIRT1002961	hsa-miR-3916	CLIP-seq
MIRT2231065	hsa-miR-3921	CLIP-seq
MIRT1003065	hsa-miR-3925-3p	CLIP-seq
MIRT1003067	hsa-miR-3935	CLIP-seq
MIRT2534987	hsa-miR-3942-5p	CLIP-seq
MIRT2231067	hsa-miR-3975	CLIP-seq
MIRT2534988	hsa-miR-4251	CLIP-seq
MIRT1003070	hsa-miR-4254	CLIP-seq
MIRT2534989	hsa-miR-4261	CLIP-seq
MIRT1997376	hsa-miR-4281	CLIP-seq
MIRT1003071	hsa-miR-4284	CLIP-seq
MIRT1002968	hsa-miR-4291	CLIP-seq
MIRT1003072	hsa-miR-4293	CLIP-seq
MIRT2534991	hsa-miR-4299	CLIP-seq
MIRT1003073	hsa-miR-4306	CLIP-seq
MIRT1003075	hsa-miR-4325	CLIP-seq
MIRT2534992	hsa-miR-4329	CLIP-seq
MIRT2534993	hsa-miR-4330	CLIP-seq
MIRT1002972	hsa-miR-4427	CLIP-seq
MIRT2388162	hsa-miR-4430	CLIP-seq
MIRT1002974	hsa-miR-4433	CLIP-seq
MIRT1997378	hsa-miR-4438	CLIP-seq
MIRT1003077	hsa-miR-4456	CLIP-seq
MIRT1002977	hsa-miR-4457	CLIP-seq
MIRT2534994	hsa-miR-4481	CLIP-seq
MIRT1002979	hsa-miR-4482	CLIP-seq
MIRT2534995	hsa-miR-4487	CLIP-seq
MIRT1003080	hsa-miR-4492	CLIP-seq
MIRT1997381	hsa-miR-4496	CLIP-seq
MIRT1003081	hsa-miR-4498	CLIP-seq
MIRT1002982	hsa-miR-4504	CLIP-seq
MIRT1003082	hsa-miR-4511	CLIP-seq
MIRT1003083	hsa-miR-451b	CLIP-seq
MIRT2231069	hsa-miR-4528	CLIP-seq
MIRT1997384	hsa-miR-4638-5p	CLIP-seq
MIRT1003085	hsa-miR-4644	CLIP-seq
MIRT2231072	hsa-miR-4653-5p	CLIP-seq
MIRT1003087	hsa-miR-4661-5p	CLIP-seq
MIRT1002989	hsa-miR-4663	CLIP-seq
MIRT1002990	hsa-miR-4666-5p	CLIP-seq
MIRT2534996	hsa-miR-4679	CLIP-seq
MIRT1002992	hsa-miR-4680-3p	CLIP-seq
MIRT2231073	hsa-miR-4680-5p	CLIP-seq
MIRT1003089	hsa-miR-4685-5p	CLIP-seq
MIRT2388163	hsa-miR-4694-3p	CLIP-seq
MIRT2231074	hsa-miR-4695-3p	CLIP-seq
MIRT2534998	hsa-miR-4703-5p	CLIP-seq
MIRT2231077	hsa-miR-4707-5p	CLIP-seq
MIRT1003092	hsa-miR-4711-5p	CLIP-seq
MIRT2231078	hsa-miR-4714-5p	CLIP-seq
MIRT1997391	hsa-miR-4720-5p	CLIP-seq
MIRT1003095	hsa-miR-4725-5p	CLIP-seq
MIRT2534999	hsa-miR-4729	CLIP-seq
MIRT1002997	hsa-miR-4731-3p	CLIP-seq
MIRT2535000	hsa-miR-4731-5p	CLIP-seq
MIRT1997393	hsa-miR-4732-3p	CLIP-seq
MIRT1997394	hsa-miR-4735-5p	CLIP-seq
MIRT1997395	hsa-miR-4743	CLIP-seq
MIRT2535002	hsa-miR-4745-5p	CLIP-seq
MIRT1003000	hsa-miR-4755-3p	CLIP-seq
MIRT2535003	hsa-miR-4758-5p	CLIP-seq
MIRT2535005	hsa-miR-4774-3p	CLIP-seq
MIRT1003002	hsa-miR-4775	CLIP-seq
MIRT1003101	hsa-miR-4782-5p	CLIP-seq
MIRT2535006	hsa-miR-4787-3p	CLIP-seq
MIRT1003004	hsa-miR-4789-3p	CLIP-seq
MIRT1003102	hsa-miR-4793-3p	CLIP-seq
MIRT1997399	hsa-miR-4799-3p	CLIP-seq
MIRT1003005	hsa-miR-4801	CLIP-seq
MIRT2535008	hsa-miR-4804-5p	CLIP-seq
MIRT2535009	hsa-miR-483-3p	CLIP-seq
MIRT2535011	hsa-miR-501-3p	CLIP-seq
MIRT2535012	hsa-miR-502-3p	CLIP-seq
MIRT1003105	hsa-miR-504	CLIP-seq
MIRT1997400	hsa-miR-5095	CLIP-seq
MIRT1997401	hsa-miR-513a-5p	CLIP-seq
MIRT1003106	hsa-miR-516b	CLIP-seq
MIRT1003109	hsa-miR-541	CLIP-seq
MIRT1003021	hsa-miR-545	CLIP-seq
MIRT2388164	hsa-miR-548g	CLIP-seq
MIRT2535013	hsa-miR-548p	CLIP-seq
MIRT2535014	hsa-miR-558	CLIP-seq
MIRT1997415	hsa-miR-574-5p	CLIP-seq
MIRT2231089	hsa-miR-579	CLIP-seq
MIRT1003029	hsa-miR-590-3p	CLIP-seq
MIRT1997416	hsa-miR-593	CLIP-seq
MIRT1003110	hsa-miR-596	CLIP-seq
MIRT1997417	hsa-miR-603	CLIP-seq
MIRT2535016	hsa-miR-615-5p	CLIP-seq
MIRT2231090	hsa-miR-628-3p	CLIP-seq
MIRT1003032	hsa-miR-642b	CLIP-seq
MIRT1997419	hsa-miR-644	CLIP-seq
MIRT1003114	hsa-miR-654-5p	CLIP-seq
MIRT2535018	hsa-miR-664	CLIP-seq
MIRT2535019	hsa-miR-708	CLIP-seq
MIRT1003116	hsa-miR-762	CLIP-seq
MIRT1003117	hsa-miR-766	CLIP-seq
MIRT1003037	hsa-miR-92a	CLIP-seq
MIRT1003038	hsa-miR-92b	CLIP-seq
MIRT1003120	hsa-miR-96	CLIP-seq
MIRT2535022	hsa-miR-99a	CLIP-seq
MIRT2535023	hsa-miR-99b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ABL1	Activation	15509806
NFKB1	Unknown	19299143
RELA	Unknown	19299143
SIRT1	Repression	17558024;21841822
SIRT3	Unknown	23665396
TP53	Unknown	19299143
TSC22D3	Repression	20018851

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18393360, 20371612, 21621563
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18787191
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	20371612
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001544	Process	Initiation of primordial ovarian follicle growth	IEA
GO:0001547	Process	Antral ovarian follicle growth	IEA
GO:0001556	Process	Oocyte maturation	IEA
GO:0003677	Function	DNA binding	IDA	21329882
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	14734530, 30513302
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	10102273, 11864996, 14976264, 15084259, 15084260, 15126506, 16809346, 18312651, 18393360, 18593906, 20181828, 20562859, 21532621, 21621563, 21909281, 22761832, 23283301, 25241761, 25609649, 28514442, 29445193, 33961781, 35271311, 35512704, 36931259
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10102273, 15084260, 16751106, 18393360, 21329882, 22761832, 23283301, 23640897, 25327288
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	29445193
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	10102273, 15084260, 16751106, 20371612, 21329882, 23283301
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	23283301
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IDA	29445193
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	29445193
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	IDA	23640897
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006390	Process	Mitochondrial transcription	IEA
GO:0006390	Process	Mitochondrial transcription	IMP	29445193
GO:0006417	Process	Regulation of translation	IDA	21329882
GO:0006915	Process	Apoptotic process	IEA
GO:0008013	Function	Beta-catenin binding	IEA
GO:0008013	Function	Beta-catenin binding	IPI	15905404
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0014737	Process	Positive regulation of muscle atrophy	IEA
GO:0014737	Process	Positive regulation of muscle atrophy	ISS
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	16751106, 18593906, 21329882
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	19188590
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031490	Function	Chromatin DNA binding	ISS
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032991	Component	Protein-containing complex	IDA	23283301, 29445193
GO:0032991	Component	Protein-containing complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	15084260
GO:0034246	Function	Mitochondrial transcription factor activity	IEA
GO:0034246	Function	Mitochondrial transcription factor activity	IMP	29445193
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0042149	Process	Cellular response to glucose starvation	IDA	29445193
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042594	Process	Response to starvation	IEA
GO:0042594	Process	Response to starvation	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IDA	20371612
GO:0043525	Process	Positive regulation of neuron apoptotic process	IMP	10102273
GO:0043565	Function	Sequence-specific DNA binding	IDA	10102273
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IDA	30513302
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IDA	14734530
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	10102273, 15084260
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	14734530
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10102273
GO:0048854	Process	Brain morphogenesis	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0070542	Process	Response to fatty acid	IEA
GO:0070542	Process	Response to fatty acid	ISS
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071386	Process	Cellular response to corticosterone stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071548	Process	Response to dexamethasone	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090571	Component	RNA polymerase II transcription repressor complex	IPI	18393360
GO:0097150	Process	Neuronal stem cell population maintenance	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:1901300	Process	Positive regulation of hydrogen peroxide-mediated programmed cell death	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	ISS
GO:1903428	Process	Positive regulation of reactive oxygen species biosynthetic process	IEA
GO:1904646	Process	Cellular response to amyloid-beta	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990785	Process	Response to water-immersion restraint stress	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000177	Process	Regulation of neural precursor cell proliferation	IEA
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA

Other IDs

• MIM: 602681
• HGNC: 3821
• e!Ensembl: ENSG00000118689

Protein

• UniProt ID: O43524
• Protein name: Forkhead box protein O3 (AF6q21 protein) (Forkhead in rhabdomyosarcoma-like 1)
• Protein function: Transcriptional activator that recognizes and binds to the DNA sequence 5'-[AG]TAAA[TC]A-3' and regulates different processes, such as apoptosis and autophagy (PubMed:10102273, PubMed:16751106, PubMed:21329882, PubMed:30513302). Acts as a positi
• PDB: 2K86, 2LQH, 2LQI, 2UZK, 6MNL, 7V9B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	157 → 244	Forkhead domain	Domain
  PF16675	FOXO_KIX_bdg	432 → 511	KIX-binding domain of forkhead box O, CR2	Family
  PF16676	FOXO-TAD	604 → 645	Transactivation domain of FOXO protein family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9479491}.
• Sequence:

  MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
  EDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS
  GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTL
  SQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG
  GKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
  DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK
  PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
  SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS
  HSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQT
  QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
  VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT
  GAKQASSQSWVPG

• Sequence length: 673

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Choroid plexus carcinoma	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	BEFREE	30240097		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	30240097		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18932267, 23828551, 26919107, 31691337		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	23380710		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19457552		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	20215638		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	26563366, 28139510, 28466777		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19380174, 20631076, 24014251, 24766860, 28099944		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	19380174		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	31312023		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	23685749		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	23295054		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23828551, 26919107, 31691337		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28641336		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	30138933		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	29141605		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34475505, 36988771, 37483002	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	37039144	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28641336		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	22718346, 22919068		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	29884740	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	29884740		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28507327, 28803777, 30691517		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28641336		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29326312, 30119891, 30439364, 30891776, 31255737		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23239110, 27214848, 30980385		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30429437, 30679758, 35008549	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39498523, 40238799	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29141605, 30414161		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29141605, 33298101, 35501805, 36675122	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	28979810		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	37345209	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	18458087		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29326312, 30119891, 30439364, 30891776, 31255737		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	21900687, 24704539, 35736168	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37017948	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24453252		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30468486, 30744415, 30778283		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	29099866	Inhibit	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	37672319	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21621268		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27898096, 28554751, 29147649, 30871066, 31802888		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	23915976		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	37976368	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	37846530	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	36768906	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	27511909	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12599246, 14527951, 15084260, 16166289, 17575143, 18239069, 19276163, 20808831, 21447726, 22336587, 22988968, 23967095, 24047697, 25647415, 26470790, 26590814, 26595803, 26643256, 27035620, 27470586, 28436938, 28969041, 29523760, 29527004, 29662632, 29967111, 30521029, 30867566, 31153828, 31243265, 31294654, 31296961, 31312024, 31357743, 31506431, 31672029, 31769419		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12599246, 14527951, 19276163, 19933843, 20371610, 20808831, 21203424, 21860419, 22336587, 22761954, 22988968, 23967095, 24047697, 24416132, 24858012, 26470790, 26675309, 27809618, 29523760, 31294654, 31575382, 32100957, 32840296, 34373837, 34502165, 34771123, 36308360, 36681070, 37635485, 38132097, 39862136	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27277416, 32332845, 37976368	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	23444223	Associate	★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	32970737	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	30045773		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22310285, 24077281, 25060657, 29079711, 30414146, 36681070	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23624922		★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	37108343	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	20808831	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19404778, 23418729, 24950290, 25053419, 25503443, 27058618, 27062697, 27249599, 27458175, 27811373, 29360760, 29361949, 29565484, 30539857, 30542728, 31132019, 33312341, 33654226, 34759291, 34803509, 35961004, 40373709	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	35123772	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27898096, 28554751, 29147649, 30871066, 31802888		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20885957, 24014251, 24814195, 25122426, 26528854, 27091996, 27541266, 28713921, 28905195, 30046347, 30209296, 30307642, 30779316		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	32142859	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28466777	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33742606, 34870494, 35308176	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34515328	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21347845, 21452041, 22159921, 22790015, 23907459, 24769729, 26054675, 28778953, 29716743, 30620384, 30941896		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	26873092, 27125259		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36702542	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36702542	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27071935, 29136142, 29415201, 30849363		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27071935, 28100865, 29415201, 30642433	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	30569095, 35008549	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	30844644, 34872443	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	35943066, 38009316	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30468486, 30595062		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	Pubtator	38009316	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27071935		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29602130		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29602130		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23828551, 25060657, 26919107, 31691337		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29915392, 31729681		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29915392	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29855350, 29953588, 30607007, 30718600, 30912765		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17496928, 21220490, 30353029		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	17496928		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21690325, 22705731, 28339038, 28578881, 29411515		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	CTD_human_DG	23099361		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cleft Palate	Cleft palate	Pubtator	34382870	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	24895270, 26455863, 35029671	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29222408		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	19636295, 28031321		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26481742	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23603907, 23624922, 25745998, 27470586, 29552117, 30185800, 30623608, 31149050		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22579651, 23828518, 24398765, 25369914, 27167185, 27825133, 28879560, 29565456, 29949152, 30064475, 30478887, 30646603, 31811910		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18852127, 21639915, 23392169, 23732517, 26657850, 28729699, 28936799, 29301589, 29949152, 30064475, 30478887, 30623608, 32373957, 33173975, 36299603, 38214831	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23828518, 34549306	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital bilateral aplasia of vas deferens	Congenital bilateral absence of vas deferens	Pubtator	32054096	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30718600, 30744415, 31380269		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24486593, 28565840, 31540495		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30323296, 31741467		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	27694344		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	27694344, 32614786	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27071935, 33260156, 34254639, 37561089	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24489705, 27071935		★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	21483870	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24035192, 24074853, 25365249, 26226934		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	25365249	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	28067912		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	28246104		★☆☆☆☆ Found in Text Mining only
Deficiency of testosterone biosynthesis	Deficiency Of Testosterone Biosynthesis	BEFREE	30311248		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19435720, 25047750, 29444976, 31232696, 31354246		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	30642433	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31570938		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29415201, 30063009		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	29415201	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28848093, 29415201		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23250986, 23805295, 26683100, 27411103, 29415201, 33260156, 37561089, 39273459	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28848093, 29415201		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32851102	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31009445, 39273459	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29859273		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22015955, 31009445, 31849586		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28678055		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	28528294		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	30271381		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	LHGDN	15551757		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	31219551		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30485839		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28778953		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29866946, 36335371	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	26476085		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	31114239		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23855308		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	24130091		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30481761		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	21974806		★☆☆☆☆ Found in Text Mining only
Food intolerance (disorder)	Food Intolerance	BEFREE	26226934		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30138933		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	21690554, 22922206	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22732497, 23621269, 27050366, 28260024, 28295288, 28560001, 29399110, 30980364, 31004738		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22732497, 27210502, 28465359	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22732497, 23621269, 27050366, 28260024, 28295288, 28560001, 29399110, 30980364, 31004738		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	20661471, 21625639, 23970205, 27633065, 27840901, 28260024, 28295288		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27448972, 32016978, 32788653	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IB	Glycogen storage disease	Pubtator	35961004	Associate	★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	26061565		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	33542676	Associate	★☆☆☆☆ Found in Text Mining only
Hamartomatous polyposis	Hamartomatous polyposis	BEFREE	25208626		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	30271381		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23810581, 29299162		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	34254639, 36252111	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21098579	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	24704539	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30718600, 30744415, 31380269		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	32217071	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	15492844, 21220490, 29695725		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	17496928		★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	34549306	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23857333	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	35507738	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18239069, 32332845	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	18363870		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	29439954	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25271153, 27390852, 28638078		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	33156570, 36902304	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	23805295, 25993007, 32705235	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23982205, 25993007, 28258028, 29100348		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	33260156, 35943066, 37483002, 37561089, 38009316	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30402830		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	31252266		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	24284420		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19473970, 22474286, 31240850, 34105393	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33742606	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31240850		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21893017, 23580232, 26186945, 29789556	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23580232, 25172912, 26186945, 29217661, 29789556		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	25172912, 37416778	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26878986		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31773668		★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27976455, 28466777		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	20808831		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30693516		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29654491		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	17108038		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	14962911		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	37553608	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29368247, 30912765		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	29627834		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34745413	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	30718600, 31380269		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18055337, 23828551, 31691337		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23828551	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20215543, 23380710, 30799283, 31533653	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	20215638	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19457552, 23380710, 25174716, 30185550, 31277439, 31533653		★☆☆☆☆ Found in Text Mining only
LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	LEUKOENCEPHALOPATHY, BRAIN CALCIFICATIONS, AND CYSTS	BEFREE	27541266		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31771044		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	36464833	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22815774, 23064420, 23418729, 23855308, 24247909, 24337611, 24372208, 24950290, 25503443, 25871400, 26089158, 27036874, 27058618, 27062697, 27541266, 29080747, 29361949, 29365018, 29565484, 30224718, 31488102, 31551254, 31695022		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26826001		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	23857333, 40284181	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	28689811		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28689811		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26089158		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20885957, 27091996, 27541266, 30642433, 34943892	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29950509		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20808831, 25743813, 34549306, 37573356	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24194912, 28139510, 28466777	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	18932267		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	18363870		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	24343700		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	21220490		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	17558024	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	28869600		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	27840901		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23810581, 29299162		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22107151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14527951, 15084260, 16166289, 17575143, 18239069, 19276163, 20808831, 21447726, 22336587, 22988968, 23967095, 24047697, 25647415, 26470790, 26590814, 26595803, 26643256, 27035620, 27470586, 28436938, 28969041, 29523760, 29527004, 29662632, 29967111, 30521029, 30867566, 31153828, 31243265, 31294654, 31296961, 31312024, 31357743, 31672029, 31769419		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29565484, 30542728		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20885957, 24014251, 24814195, 25122426, 26528854, 27091996, 27541266, 28713921, 28905195, 30046347, 30209296, 30307642, 30779316		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31771044		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21347845, 21452041, 22159921, 22790015, 24077281, 24769729, 26054675, 29716743, 30620384, 30941896		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27893718, 29072689, 29500870, 30464602, 31087222		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12351634, 17563745, 19424579, 21436588, 21725602, 23492774, 23765843, 25431082, 26089375, 26913603, 27699813, 28122308, 28345464, 28494348, 28986382, 29131261, 29518547, 29676828, 31232159, 31312023, 31593800, 31733095		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28249743		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16627973, 26540566, 30138933, 30628514, 30816512, 30853185, 31828217		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24684457, 28220348		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	27080223		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27898096, 28554751, 29147649, 30871066, 31802888		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16861905, 17473381, 19564415, 21107437, 21138866, 21725602, 22474286, 22493319, 22582938, 22713244, 23706767, 24360957, 24865442, 24947616, 25202904, 25208626, 25418858, 25554016, 25791921, 26397839, 26657152, 27091996, 27699813, 27881235, 27886165, 28087388, 28468801, 28507102, 28869600, 28945225, 29136142, 29180117, 29445193, 29533768, 29928344, 30015975, 30045773, 30185550, 30598523, 30717152, 31294654, 31312024, 31533653, 31591479, 31801949, 9345057		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29602130		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23603907, 23624922, 24865442, 27470586, 29552117, 30185800, 30623608, 31149050		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14527951, 18037997, 18312651		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24047697, 26397839, 26643256		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22107151, 31517438		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16861905, 18426407, 22892845, 25238278, 28249743, 29498217		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16861905, 28358423, 29498217	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	19188590		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29415201, 30063009		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30577593		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	33260156	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metastatic melanoma	Metastatic Melanoma	BEFREE	19188590		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31849586		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34105393	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17574214		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	28638078		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	31771044, 34117688	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	25470651	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	27312110	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29664021		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	29124072		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	29124072, 32217071, 34183647	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12456669, 17900262, 18644865, 20130650		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	20130650		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23382383		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	29049183	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30323296, 31741467		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29136142		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	28881481		★☆☆☆☆ Found in Text Mining only
Nail Diseases	Nail Diseases	BEFREE	29937556		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	24806432, 31539126, 32281513, 36947579	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31022422, 31727006		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25802279	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15084260, 15668399, 18431742, 19424579, 19564415, 19636295, 20541034, 21092744, 21107437, 21249150, 21639915, 21690554, 21725602, 21915097, 21974806, 21980390, 22107151, 22474286, 22579651, 22582938, 22718346, 22892845, 22971992, 23392169, 23514751, 23603907, 23810581, 23828518, 23856247, 23967095, 24077281, 24486593, 24947616, 25060657, 25122426, 25202904, 25238278, 25418858, 25431082, 25554016, 25745998, 26657152, 26764572, 26913603, 27367029, 27669435, 27699813, 27769056, 27825133, 27886165, 27893718, 28099944, 28139510, 28220348, 28229217, 28398822, 28466777, 28521392, 28729699, 28819023, 28945225, 29113252, 29115437, 29257235, 29269868, 29301793, 29399110, 29540677, 29565484, 29618792, 29620202, 29991500, 30045773, 30172026, 30205794, 30260725, 30261584, 30353029, 30414146, 30514328, 30623608, 30745827, 30753811, 30853185, 30980364, 31022422, 31158953, 31243265, 31289511, 31357743, 31367332, 31421153, 31488102, 31591479, 31599414, 31629677, 31771044		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	23982205, 30312583		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	16133873, 19211844, 19285077, 22493319, 23378341, 25261981, 28545464, 28869600, 31591479, 31861249	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16888645, 19211844, 22493319, 23378341, 25261981, 27769056, 28415610, 28545464, 28869600, 31591479		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19714246, 35029671	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19714246		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28427239, 31729980		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	19380174		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25286764, 25948105, 28840963, 29620202, 30046347, 30738830, 31844042		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	24047697		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	23954404		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	26045339	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	30320911, 30577593		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	35968712	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	31232696, 33791375, 33853636, 38554527	Associate	★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	33149812, 35354753	Associate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	33791375	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30318050		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	25208626, 31232696, 38043828, 39383820, 40517505	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30146742		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28744393, 29928344, 29987368, 30627573, 31074088		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30627573, 36438897, 36823640	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22790015		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	16979636, 17959613, 20219431		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19160093		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21347845, 21452041, 22159921, 22790015, 24769729, 26054675, 29716743, 30620384, 30941896		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22790015, 24769729, 25096914, 26151347, 28139510, 31013711, 31957819, 35283423, 36587749	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24077281	Inhibit	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34555810	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27893718, 29072689, 29500870, 30464602, 31087222		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	28466777, 28507102, 30691517		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	22971992		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29072689, 29500870, 31599414	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21249150, 27258970		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24158851, 28638078		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34204164	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26993517		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32869942	Associate	★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	18932267, 26919107, 31691337		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	22713244, 23828551, 30598523		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	28228489		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	16979636, 17959613, 20219431		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31570938		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	23295054		★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	BEFREE	17959613		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	23295054		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17563745, 19424579, 21436588, 21725602, 23492774, 23765843, 25431082, 26089375, 26913603, 27699813, 28122308, 28345464, 28494348, 28986382, 29676828, 31232159, 31312023, 31593800, 31733095		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12351634, 15798096, 16061480, 17522055, 18687691, 19424579, 23492774, 29131261, 29211704, 31232159, 35488328	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15798096, 16061480		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19424579, 31312023		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31733095	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29937556		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	31240850	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18415806	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29411515	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31684967	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	21690325, 22546858		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25172912, 29217661, 29907991		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	31085559, 34876692, 37416778	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31540495		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29915018		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	29141605		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	29141605	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	26574636		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15342383		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17873969, 19435720, 24035192, 24074853, 27214848, 30208760, 30679758, 30980385, 31541023		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	29141605	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	28139510	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	26198764, 28991256, 30285260, 31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	29136250		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	29141862		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	29141862	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	27825133		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29100348		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	30172026		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	27058291, 30172026	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29953588		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30015975, 30779316		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	35784335	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21109483, 26563366, 31629677		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30514328, 31680314		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	30978209, 32406610, 34117688, 36700826	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	20631076		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23810581, 29269868		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23855308		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16627973, 30138933, 30628514, 30816512, 30853185, 31828217		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24194912, 25109605, 26045805, 26540566, 27127880, 34943892	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30138933	Inhibit	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	27071935	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30791908		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	24865442		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	24865442	Inhibit	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	30679758	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29141862		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	21347845		★☆☆☆☆ Found in Text Mining only
Thymic epithelial tumor	Thymic tumor	BEFREE	28819023		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	35338124	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	21974806		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24684457, 28220348		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	22718346	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	30271381		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24684457, 28220348		★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	30595062		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30595062		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25132260, 26590814, 27793938, 28280414, 29527004, 29588373		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36681070	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24583476, 26481742		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28229220, 34332039, 37573356	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	28466777	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23819460, 36653180	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	24130091		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	27881235, 29257235		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	32347651	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29326312		★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	31240850	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	21098579	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	37039144	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	24333267		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	24333267		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	25893290	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	34515328	Inhibit	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	35795985	Associate	★☆☆☆☆ Found in Text Mining only