FOXD4L4 (forkhead box D4 like 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 349334
• Gene name: Forkhead box D4 like 4
• Gene symbol: FOXD4L4
• Synonyms (NCBI Gene): FOXD4L2, FOXD4b, bA460E7.2
• Chromosome: 9
• Chromosome location: 9q21.11

miRNA Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT445503	hsa-miR-605-3p	PAR-CLIP	22100165
MIRT445502	hsa-miR-6786-3p	PAR-CLIP	22100165
MIRT445501	hsa-miR-31-5p	PAR-CLIP	22100165
MIRT445503	hsa-miR-605-3p	PAR-CLIP	22100165
MIRT445502	hsa-miR-6786-3p	PAR-CLIP	22100165
MIRT445501	hsa-miR-31-5p	PAR-CLIP	22100165
MIRT2230742	hsa-miR-4729	CLIP-seq
MIRT2230743	hsa-miR-511	CLIP-seq
MIRT2230744	hsa-miR-579	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA

Other IDs

• MIM: 611085
• HGNC: 23762
• e!Ensembl: ENSG00000184659

Protein

• UniProt ID: Q8WXT5
• Protein name: Forkhead box protein D4-like 4 (FOXD4-like 4) (Forkhead box protein D4-like 2) (Forkhead box protein D4B) (Myeloid factor-gamma)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	107 → 193	Forkhead domain	Domain

• Sequence:

  MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEARQQFLEQSLQPGLQ
  VARWGGVALPREHIEGGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPPYSYIALITMA
  ILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGN
  YWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPHPGPLLGAP
  APPQPVPGAYPNTAPGRRPYALLHPHPLRYLLLSARVYAGAPKKAEGADLATPAPFPCCS
  PHLVLSLGRRARVWRRHREADASLSALRVLCKGSGERVQGLRRVCPRPRGATATCSSDHQ
  ACCIPKPLPLCCKCPPPLLLGQFCSNSSSIRRTAPTAALPPRARCWAGTCRPRRRC

• Sequence length: 416

Related Genes

No strongly related genes found yet for FOXD4L4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FOXD4L4.