FOXD4L1 (forkhead box D4 like 1)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 200350
• Gene name: Forkhead box D4 like 1
• Gene symbol: FOXD4L1
• Synonyms (NCBI Gene): FOXD5, bA395L14.1
• Chromosome: 2
• Chromosome location: 2q14.1
• Summary: This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer.

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT447025	hsa-miR-605-3p	PAR-CLIP	22100165
MIRT447024	hsa-miR-6786-3p	PAR-CLIP	22100165
MIRT447023	hsa-miR-31-5p	PAR-CLIP	22100165
MIRT447025	hsa-miR-605-3p	PAR-CLIP	22100165
MIRT447024	hsa-miR-6786-3p	PAR-CLIP	22100165
MIRT447023	hsa-miR-31-5p	PAR-CLIP	22100165
MIRT1001602	hsa-miR-31	CLIP-seq
MIRT1001603	hsa-miR-365	CLIP-seq
MIRT1001604	hsa-miR-4286	CLIP-seq
MIRT1001605	hsa-miR-4325	CLIP-seq
MIRT1001606	hsa-miR-450b-5p	CLIP-seq
MIRT1001607	hsa-miR-4786-3p	CLIP-seq
MIRT1001608	hsa-miR-507	CLIP-seq
MIRT1001609	hsa-miR-557	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA

Other IDs

• MIM: 611084
• HGNC: 18521
• e!Ensembl: ENSG00000184492

Protein

• UniProt ID: Q9NU39
• Protein name: Forkhead box protein D4-like 1 (FOXD4-like 1)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	106 → 192	Forkhead domain	Domain

• Sequence:

  MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPGLQ
  VARWGGVALPREHIEGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPYSYIALITMAI
  LQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTY
  WSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPRPGPLLGAPA
  LPQPVPGAYPNTAPGRRPYALLHPHPPRYLLLSAPAYAGAPKKAEGADLATPGTLPVLQP
  SLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSS
  LSDNFAATAAASGGGLRQRLRSHQGRGAGRAPVGRVGAAAVSGGGRGL

• Sequence length: 408

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35817785	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31367490		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for FOXD4L1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FOXD4L1.