FOXD4 (forkhead box D4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 2298
• Gene name: Forkhead box D4
• Gene symbol: FOXD4
• Synonyms (NCBI Gene): FKHL9, FOXD4A, FREAC-5, FREAC5
• Chromosome: 9
• Chromosome location: 9p24.3
• Summary: This gene encodes a member of the forkhead/winged helix-box (FOX) family of transcription factors. FOX transcription factors play critical roles in the regulation of multiple processes including metabolism, cell proliferation and gene expression during on

miRNA Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT445241	hsa-miR-605-3p	PAR-CLIP	22100165
MIRT445240	hsa-miR-6786-3p	PAR-CLIP	22100165
MIRT445239	hsa-miR-31-5p	PAR-CLIP	22100165
MIRT445241	hsa-miR-605-3p	PAR-CLIP	22100165
MIRT445240	hsa-miR-6786-3p	PAR-CLIP	22100165
MIRT445239	hsa-miR-31-5p	PAR-CLIP	22100165
MIRT1001595	hsa-miR-155	CLIP-seq
MIRT1001596	hsa-miR-365	CLIP-seq
MIRT1001597	hsa-miR-4286	CLIP-seq
MIRT1001598	hsa-miR-4325	CLIP-seq
MIRT1001599	hsa-miR-450b-5p	CLIP-seq
MIRT1001600	hsa-miR-507	CLIP-seq
MIRT1001601	hsa-miR-557	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9325056
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008301	Function	DNA binding, bending	ISS	7957066
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0030154	Process	Cell differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS	7957066

Other IDs

• MIM: 601092
• HGNC: 3805
• e!Ensembl: ENSG00000170122

Protein

• UniProt ID: Q12950
• Protein name: Forkhead box protein D4 (Forkhead-related protein FKHL9) (Forkhead-related transcription factor 5) (FREAC-5) (Myeloid factor-alpha)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00250	Forkhead	103 → 189	Forkhead domain	Domain

• Sequence:

  MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEEEAASQQFLEQSLQPGLQVARW
  GGVALPREHIEGGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPSSYIALITMAILQS
  PHKRLTLSGICAFISDRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGRPGKGNYWSL
  DPASQDMFDNGSFLRRRKRFQRHQPTPGAHLPHPFPLPAAHAALHNPRPGPLLGAPAPPQ
  PVPGAYPNTGPGRRPYALLHPHPPRYLLLSAPAYAGAPKKAEGADLATPAPFPCCSPHLV
  LSLGRRARVWRRHREADASLSALRVSCKGSGERVQGLRRVCPRPRGATAPCSSDRQACRT
  ILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTS
  PVFLVSPTPSSLAESAGPS

• Sequence length: 439

Related Genes

No strongly related genes found yet for FOXD4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FOXD4.