FNTA (farnesyltransferase, CAAX box, subunit alpha)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2339
• Gene name: Farnesyltransferase, CAAX box, subunit alpha
• Gene symbol: FNTA
• Synonyms (NCBI Gene): FPTA, PGGT1A, PTAR2
• Chromosome: 8
• Chromosome location: 8p11.21
• Summary: Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share th

miRNA Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031435	hsa-miR-16-5p	Proteomics	18668040
MIRT736199	hsa-miR-451a	Luciferase reporter assay, qRT-PCR	31897215
MIRT1000894	hsa-miR-1256	CLIP-seq
MIRT1000895	hsa-miR-1271	CLIP-seq
MIRT1000896	hsa-miR-1537	CLIP-seq
MIRT1000897	hsa-miR-182	CLIP-seq
MIRT1000898	hsa-miR-4259	CLIP-seq
MIRT1000899	hsa-miR-451	CLIP-seq
MIRT1000900	hsa-miR-4642	CLIP-seq
MIRT1000901	hsa-miR-4715-5p	CLIP-seq
MIRT1000902	hsa-miR-96	CLIP-seq
MIRT1996536	hsa-miR-3115	CLIP-seq
MIRT1996537	hsa-miR-3199	CLIP-seq
MIRT1996538	hsa-miR-4659a-3p	CLIP-seq
MIRT1996539	hsa-miR-4659b-3p	CLIP-seq
MIRT1996540	hsa-miR-4691-5p	CLIP-seq
MIRT1996541	hsa-miR-556-3p	CLIP-seq
MIRT2230573	hsa-miR-3166	CLIP-seq
MIRT2230574	hsa-miR-3659	CLIP-seq
MIRT2230575	hsa-miR-3938	CLIP-seq
MIRT2230576	hsa-miR-3944-5p	CLIP-seq
MIRT2230577	hsa-miR-4658	CLIP-seq
MIRT2230578	hsa-miR-4742-3p	CLIP-seq
MIRT2230579	hsa-miR-4771	CLIP-seq
MIRT2230580	hsa-miR-574-5p	CLIP-seq
MIRT2230581	hsa-miR-630	CLIP-seq
MIRT2230582	hsa-miR-648	CLIP-seq
MIRT1996536	hsa-miR-3115	CLIP-seq
MIRT1996537	hsa-miR-3199	CLIP-seq
MIRT1996538	hsa-miR-4659a-3p	CLIP-seq
MIRT1996539	hsa-miR-4659b-3p	CLIP-seq
MIRT1996540	hsa-miR-4691-5p	CLIP-seq
MIRT2534590	hsa-miR-1283	CLIP-seq
MIRT2534591	hsa-miR-1321	CLIP-seq
MIRT2534592	hsa-miR-28-5p	CLIP-seq
MIRT2534593	hsa-miR-300	CLIP-seq
MIRT1996536	hsa-miR-3115	CLIP-seq
MIRT2534594	hsa-miR-3126-5p	CLIP-seq
MIRT2534595	hsa-miR-3139	CLIP-seq
MIRT2534596	hsa-miR-3160-3p	CLIP-seq
MIRT2534597	hsa-miR-3161	CLIP-seq
MIRT1996537	hsa-miR-3199	CLIP-seq
MIRT2534598	hsa-miR-381	CLIP-seq
MIRT2534599	hsa-miR-4419a	CLIP-seq
MIRT2534600	hsa-miR-4432	CLIP-seq
MIRT2534601	hsa-miR-4475	CLIP-seq
MIRT2534602	hsa-miR-4510	CLIP-seq
MIRT2534603	hsa-miR-4639-5p	CLIP-seq
MIRT1996538	hsa-miR-4659a-3p	CLIP-seq
MIRT1996539	hsa-miR-4659b-3p	CLIP-seq
MIRT1996540	hsa-miR-4691-5p	CLIP-seq
MIRT2534604	hsa-miR-4739	CLIP-seq
MIRT2534605	hsa-miR-4756-5p	CLIP-seq
MIRT2534606	hsa-miR-4760-5p	CLIP-seq
MIRT2534607	hsa-miR-4777-3p	CLIP-seq
MIRT2534608	hsa-miR-4781-3p	CLIP-seq
MIRT2534609	hsa-miR-499-5p	CLIP-seq
MIRT2534610	hsa-miR-708	CLIP-seq
MIRT2534611	hsa-miR-765	CLIP-seq
MIRT2534612	hsa-miR-885-5p	CLIP-seq
MIRT2534590	hsa-miR-1283	CLIP-seq
MIRT2534591	hsa-miR-1321	CLIP-seq
MIRT2534592	hsa-miR-28-5p	CLIP-seq
MIRT1996536	hsa-miR-3115	CLIP-seq
MIRT2534594	hsa-miR-3126-5p	CLIP-seq
MIRT2534595	hsa-miR-3139	CLIP-seq
MIRT2534596	hsa-miR-3160-3p	CLIP-seq
MIRT2534597	hsa-miR-3161	CLIP-seq
MIRT1996537	hsa-miR-3199	CLIP-seq
MIRT2534599	hsa-miR-4419a	CLIP-seq
MIRT2534600	hsa-miR-4432	CLIP-seq
MIRT2534601	hsa-miR-4475	CLIP-seq
MIRT2534602	hsa-miR-4510	CLIP-seq
MIRT2534603	hsa-miR-4639-5p	CLIP-seq
MIRT1996538	hsa-miR-4659a-3p	CLIP-seq
MIRT1996539	hsa-miR-4659b-3p	CLIP-seq
MIRT1996540	hsa-miR-4691-5p	CLIP-seq
MIRT2534604	hsa-miR-4739	CLIP-seq
MIRT2534605	hsa-miR-4756-5p	CLIP-seq
MIRT2534606	hsa-miR-4760-5p	CLIP-seq
MIRT2534607	hsa-miR-4777-3p	CLIP-seq
MIRT2534608	hsa-miR-4781-3p	CLIP-seq
MIRT2534609	hsa-miR-499-5p	CLIP-seq
MIRT2534610	hsa-miR-708	CLIP-seq
MIRT2534611	hsa-miR-765	CLIP-seq

Gene ontology (GO) Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004659	Function	Prenyltransferase activity	IEA
GO:0004660	Function	Protein farnesyltransferase activity	IBA
GO:0004660	Function	Protein farnesyltransferase activity	IDA	19228685
GO:0004660	Function	Protein farnesyltransferase activity	IDA	16893176
GO:0004660	Function	Protein farnesyltransferase activity	IEA
GO:0004660	Function	Protein farnesyltransferase activity	TAS	8276393
GO:0004661	Function	Protein geranylgeranyltransferase activity	IDA	16893176
GO:0004661	Function	Protein geranylgeranyltransferase activity	IEA
GO:0004661	Function	Protein geranylgeranyltransferase activity	TAS	8106351
GO:0004662	Function	CAAX-protein geranylgeranyltransferase activity	IBA
GO:0004662	Function	CAAX-protein geranylgeranyltransferase activity	IEA
GO:0004663	Function	Rab geranylgeranyltransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	11687658, 12036349, 12825937, 15170324, 15248757, 15451670, 24981860, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	TAS	8599089
GO:0005829	Component	Cytosol	TAS
GO:0005875	Component	Microtubule associated complex	IDA	19228685
GO:0005886	Component	Plasma membrane	IEA
GO:0005953	Component	CAAX-protein geranylgeranyltransferase complex	IBA
GO:0005953	Component	CAAX-protein geranylgeranyltransferase complex	IDA	16893176
GO:0005953	Component	CAAX-protein geranylgeranyltransferase complex	IPI	8106351
GO:0005965	Component	Protein farnesyltransferase complex	IBA
GO:0005965	Component	Protein farnesyltransferase complex	IDA	16893176
GO:0006998	Process	Nuclear envelope organization	IDA	2188730
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	TAS	8599089
GO:0007323	Process	Peptide pheromone maturation	IBA
GO:0007528	Process	Neuromuscular junction development	IEA
GO:0008017	Function	Microtubule binding	IDA	19228685
GO:0008318	Function	Protein prenyltransferase activity	IEA
GO:0010698	Function	Acetyltransferase activator activity	IDA	19228685
GO:0016740	Function	Transferase activity	IEA
GO:0018343	Process	Protein farnesylation	IDA	16893176
GO:0018343	Process	Protein farnesylation	TAS	8494894
GO:0018344	Process	Protein geranylgeranylation	IDA	16893176
GO:0018344	Process	Protein geranylgeranylation	TAS	8106351
GO:0019899	Function	Enzyme binding	IPI	19228685
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0043014	Function	Alpha-tubulin binding	IDA	19228685
GO:0051604	Process	Protein maturation	IDA	33293369
GO:0060090	Function	Molecular adaptor activity	EXP	11687658
GO:0060632	Process	Regulation of microtubule-based movement	IDA	19228685
GO:0071340	Process	Skeletal muscle acetylcholine-gated channel clustering	IEA
GO:1904395	Process	Positive regulation of skeletal muscle acetylcholine-gated channel clustering	IEA

Other IDs

• MIM: 134635
• HGNC: 3782
• e!Ensembl: ENSG00000168522

Protein

• UniProt ID: P49354
• Protein name: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha (EC 2.5.1.58) (EC 2.5.1.59) (CAAX farnesyltransferase subunit alpha) (FTase-alpha) (Ras proteins prenyltransferase subunit alpha) (Type I protein geranyl-geranyltransferase subunit
• Protein function: Essential subunit of both the farnesyltransferase and the geranylgeranyltransferase complex. Contributes to the transfer of a farnesyl or geranylgeranyl moiety from farnesyl or geranylgeranyl diphosphate to a cysteine at the fourth position from
• PDB: 1JCQ , 1LD7 , 1LD8 , 1MZC , 1S63 , 1SA4 , 1TN6 , 2F0Y , 2H6F , 2H6G , 2H6H , 2H6I , 2IEJ , 3E37
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01239	PPTA	182 → 213	Protein prenyltransferase alpha subunit repeat	Repeat
  PF01239	PPTA	148 → 179	Protein prenyltransferase alpha subunit repeat	Repeat
  PF01239	PPTA	113 → 144	Protein prenyltransferase alpha subunit repeat	Repeat
  PF01239	PPTA	216 → 247	Protein prenyltransferase alpha subunit repeat	Repeat
  PF01239	PPTA	256 → 286	Protein prenyltransferase alpha subunit repeat	Repeat

• Sequence:

  MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDS
  PSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLT
  RDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLR
  DPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
  YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLL
  DLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
  RSLQSKHSTENDSPTNVQQ

• Sequence length: 379

Pathways

KEGG Pathway	Reactome Pathway
Terpenoid backbone biosynthesis	Apoptotic cleavage of cellular proteins
	Inactivation, recovery and regulation of the phototransduction cascade

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Uveal melanoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	17157792	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	8971720		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21848520		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CHURC1-FNTB 2 shared pathwaysTerpenoid backbone biosynthesis, Inactivation, recovery and regulation of the phototransduction cascade Related via 2 shared pathways including Terpenoid backbone biosynthesis, Inactivation, recovery and regulation of the phototransduction cascade. FNTB 2 shared pathwaysTerpenoid backbone biosynthesis, Inactivation, recovery and regulation of the phototransduction cascade Related via 2 shared pathways including Terpenoid backbone biosynthesis, Inactivation, recovery and regulation of the phototransduction cascade.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CHURC1-FNTB	0	[]	2	["Terpenoid backbone biosynthesis","Inactivation, recovery and regulation of the phototransduction cascade"]	0	[]
FNTB	0	[]	2	["Terpenoid backbone biosynthesis","Inactivation, recovery and regulation of the phototransduction cascade"]	0	[]

Diseases Linked via Similar Genes

Lung cancer Linked via 1 of 2 related genesCHURC1-FNTB Squamous cell carcinoma Linked via 1 of 2 related genesCHURC1-FNTB Anxiety disorder Linked via 1 of 2 related genesFNTB

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Lung cancer	1	["CHURC1-FNTB"]
Squamous cell carcinoma	1	["CHURC1-FNTB"]
Anxiety disorder	1	["FNTB"]