FNDC8 (fibronectin type III domain containing 8)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 54752
Gene name Fibronectin type III domain containing 8
Gene symbol FNDC8
Synonyms (NCBI Gene)
-
Chromosome 17
Chromosome location 17q12
miRNA miRNA information provided by mirtarbase database.
16 Show/Hide all (16)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1000658 hsa-miR-3649 CLIP-seq
MIRT1000659 hsa-miR-4690-3p CLIP-seq
MIRT2230487 hsa-miR-1915 CLIP-seq
MIRT2230488 hsa-miR-342-5p CLIP-seq
MIRT2230489 hsa-miR-4641 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 33961781
GO:0005634 Component Nucleus HDA 21630459
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8TC99
Protein name Fibronectin type III domain-containing protein 8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00041 fn3 180 → 270 Fibronectin type III domain Domain
Sequence 
MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGLPLASKGNLVN
FLEDDTINLLKPLPVEDSDCSSDETSISAFSSTLLNPIKLAVTQPNSSFFAGMLEGELNK
LSFSPMAKNAENEDLALGPCPCPSKSQMATRGLLDLDNPELETETSSTHSESSVVVDLPD
TPFIFEHTVNNSTAVISWTYALGKQPVSFYQLLLQEVAKTQENELPEAKNRPWIFNKILG
TTVKLMELKPNTCYCLSVRAANTAGVGKWCKPYKFATLATDFSSFPENYPIQITVRRKEP
RQKIVSIGPEEMRRLEDLEYLFPC
Sequence length 324
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Breast-ovarian cancer, familial, susceptibility to, 4 Uncertain significance ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations

No strongly related genes found yet for FNDC8.

No additional diseases found yet through genes similar to FNDC8.