FLVCR1-DT (FLVCR1 divergent transcript)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 642946 |
| Gene name | FLVCR1 divergent transcript |
| Gene symbol | FLVCR1-DT |
| Synonyms (NCBI Gene) |
FLVCR1-AS1LQK1NCRNA00292
|
| Chromosome | 1 |
| Chromosome location | 1q32.3 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8TAF5 |
| Protein name | Putative uncharacterized protein LQK1 (FLVCR1 antisense RNA 1) (FLVCR1 divergent transcript) |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Expressed in a wide variety of tissues. {ECO:0000269|PubMed:11943475}. |
| Sequence |
MARGLLHLRVGGRRPRGLCCWKKGSRSRPQERVLGSTSGKNWRRVTERSEGSKFIGIYSV |
| Sequence length | 88 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with FLVCR1-DT across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to FLVCR1-DT (see Related Genes above), that are NOT already directly curated for FLVCR1-DT itself -- a lead worth checking, not a confirmed association.
0
|
|