FLT3 (fms related receptor tyrosine kinase 3)

Gene

• Entrez ID: 2322
• Gene name: Fms related receptor tyrosine kinase 3
• Gene symbol: FLT3
• Synonyms (NCBI Gene): CD135, FLK-2, FLK2, STK1
• Chromosome: 13
• Chromosome location: 13q12.2
• Summary: This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. This receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane le

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121909646	T>A,G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs121913232	G>C	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs121913486	ATC>-	Pathogenic-likely-pathogenic	Inframe deletion, non coding transcript variant, coding sequence variant
rs121913487	A>C,T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs121913488	C>A,G,T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs121913490	GAT>-	Likely-pathogenic	Inframe deletion, non coding transcript variant, coding sequence variant
rs121913491	T>C	Likely-pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs376588714	T>C	Likely-pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs398122514	->TCCGGA	Pathogenic	Coding sequence variant, non coding transcript variant, inframe insertion
rs587776834	TCA>-	Pathogenic	Non coding transcript variant, inframe deletion, coding sequence variant
rs749281035	G>A,T	Likely-pathogenic	Non coding transcript variant, synonymous variant, missense variant, coding sequence variant
rs772061268	T>G	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs864321619	->CATATTCTCTGAAATCAACGT	Pathogenic	Inframe insertion, coding sequence variant, non coding transcript variant
rs991132188	T>C	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519726	T>A,C,G	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519762	A>G	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519763	TC>AA	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519764	A>C,T	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519765	T>A,C	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519766	G>C,T	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519767	T>C	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519768	T>C	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057519769	C>A	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057520021	A>C,G	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057520022	A>G	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057520023	A>C	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057520024	T>C	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057520025	A>G	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057520026	T>G	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1057520043	A>C	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1208575764	A>G	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs1555256794	G>-	Drug-response	5 prime UTR variant, frameshift variant, coding sequence variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007053	hsa-miR-150-5p	Luciferase reporter assay	23079661
MIRT017462	hsa-miR-335-5p	Microarray	18185580
MIRT999065	hsa-miR-15a	CLIP-seq
MIRT999066	hsa-miR-15b	CLIP-seq
MIRT999067	hsa-miR-16	CLIP-seq
MIRT999068	hsa-miR-195	CLIP-seq
MIRT999069	hsa-miR-3161	CLIP-seq
MIRT999070	hsa-miR-424	CLIP-seq
MIRT999071	hsa-miR-4299	CLIP-seq
MIRT999072	hsa-miR-4456	CLIP-seq
MIRT999073	hsa-miR-497	CLIP-seq
MIRT999074	hsa-miR-548q	CLIP-seq
MIRT999065	hsa-miR-15a	CLIP-seq
MIRT999066	hsa-miR-15b	CLIP-seq
MIRT999067	hsa-miR-16	CLIP-seq
MIRT999068	hsa-miR-195	CLIP-seq
MIRT999069	hsa-miR-3161	CLIP-seq
MIRT999070	hsa-miR-424	CLIP-seq
MIRT999071	hsa-miR-4299	CLIP-seq
MIRT999072	hsa-miR-4456	CLIP-seq
MIRT999073	hsa-miR-497	CLIP-seq
MIRT999074	hsa-miR-548q	CLIP-seq
MIRT2681049	hsa-miR-3140-3p	CLIP-seq
MIRT2681050	hsa-miR-3924	CLIP-seq
MIRT2681051	hsa-miR-4699-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PML	Activation	17124055
STAT3	Activation	16418395

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001776	Process	Leukocyte homeostasis	ISS
GO:0002318	Process	Myeloid progenitor cell differentiation	ISS
GO:0002328	Process	Pro-B cell differentiation	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	TAS	19549778
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004896	Function	Cytokine receptor activity	ISS
GO:0005021	Function	Vascular endothelial growth factor receptor activity	TAS	8394751
GO:0005515	Function	Protein binding	IPI	16982329, 20098747, 23246379, 24525236, 27458164, 28086240
GO:0005524	Function	ATP binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS	8394751
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	7507245
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7507245, 19549778
GO:0010008	Component	Endosome membrane	TAS
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	TAS	19549778
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019838	Function	Growth factor binding	IBA
GO:0030097	Process	Hemopoiesis	IDA	7507245
GO:0030097	Process	Hemopoiesis	IEA
GO:0030183	Process	B cell differentiation	IBA
GO:0030183	Process	B cell differentiation	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IEA
GO:0035726	Process	Common myeloid progenitor cell proliferation	ISS
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	TAS	19549778
GO:0042981	Process	Regulation of apoptotic process	TAS	19549778
GO:0043235	Component	Receptor complex	IBA
GO:0043406	Process	Positive regulation of MAP kinase activity	TAS	19549778
GO:0043410	Process	Positive regulation of MAPK cascade	TAS	19549778
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046651	Process	Lymphocyte proliferation	ISS
GO:0046777	Process	Protein autophosphorylation	TAS	19549778
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	TAS	12951584
GO:0071345	Process	Cellular response to cytokine stimulus	ISS
GO:0071345	Process	Cellular response to cytokine stimulus	TAS	19549778
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IEA
GO:0097028	Process	Dendritic cell differentiation	ISS
GO:0097421	Process	Liver regeneration	IEA
GO:0141038	Function	Phosphatidylinositol 3-kinase activator activity	TAS	12951584

Other IDs

• MIM: 136351
• HGNC: 3765
• e!Ensembl: ENSG00000122025

Protein

• UniProt ID: P36888
• Protein name: Receptor-type tyrosine-protein kinase FLT3 (EC 2.7.10.1) (FL cytokine receptor) (Fetal liver kinase-2) (FLK-2) (Fms-like tyrosine kinase 3) (FLT-3) (Stem cell tyrosine kinase 1) (STK-1) (CD antigen CD135)
• Protein function: Tyrosine-protein kinase that acts as a cell-surface receptor for the cytokine FLT3LG and regulates differentiation, proliferation and survival of hematopoietic progenitor cells and of dendritic cells. Promotes phosphorylation of SHC1 and AKT1, a
• PDB: 1RJB, 3QS7, 3QS9, 4RT7, 4XUF, 5X02, 6IL3, 6JQR, 7QDP, 7ZV9, 8XB1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	255 → 345	Immunoglobulin domain	Domain
  PF07714	PK_Tyr_Ser-Thr	610 → 943	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in bone marrow, in hematopoietic stem cells, in myeloid progenitor cells and in granulocyte/macrophage progenitor cells (at protein level). Detected in bone marrow, liver, thymus, spleen and lymph node, and at low levels in ki
• Sequence:

  MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
  EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
  QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
  ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
  CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
  STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
  IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
  ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
  GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
  NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
  LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
  ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
  HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
  NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
  NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
  LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
  RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS

• Sequence length: 993

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acute lymphoid leukemia	Pathogenic	rs121909646, rs121913488, rs587776834	RCV000017661 RCV000017666 RCV000017668	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Acute myeloid leukemia	Likely pathogenic; Pathogenic	rs2137622655, rs398122514, rs121909646, rs121913488, rs121913486, rs121913487, rs121913491	RCV003314385 RCV000017659 RCV000017660 RCV000017662 RCV000017663 RCV000017665 RCV000017667 RCV000424615 RCV006252530	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Multiple myeloma	Likely pathogenic	rs1208575764	RCV000984136	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Myelodysplastic syndrome progressed to acute myeloid leukemia	Pathogenic	rs864321619	RCV000203482	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-LYMPHOBLASTIC LEUKEMIA/LYMPHOMA WITH T	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FLT3-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, ACUTE LYMPHOBLASTIC	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, ACUTE MYELOID	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	30858955		★☆☆☆☆ Found in Text Mining only
Acute erythroleukemia	Erythroleukemia	CTD_human_DG	30926971		★☆☆☆☆ Found in Text Mining only
Acute erythroleukemia - M6a subtype	Erythroleukemia	CTD_human_DG	30926971		★☆☆☆☆ Found in Text Mining only
Acute erythroleukemia - M6b subtype	Erythroleukemia	CTD_human_DG	30926971		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	12908554, 12969963, 1384791, 15161429, 15778081, 15996732, 15996933, 16025155, 16146839, 16418499, 17233551, 17268528, 17387224, 17943971, 18925699, 19411632, 20370649, 20515557, 21133602, 21272320, 21387358, 22261446, 22643831, 22674806, 23086275, 23497317, 24269847, 24724602, 24735609, 24991719, 25530565, 26891877, 26920889, 27636998, 27872057, 29558838, 31201827, 7535088, 8562934, 8677746		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10233379, 12400596, 12529667, 14504097, 14604973, 15044257, 15604885, 15956279, 15982343, 16116483, 16533526, 16867903, 17156841, 17205058, 17942916, 18663058, 18760705, 18925699, 19085113, 21112035, 21133602, 21272320, 21387358, 22049994, 22390761, 22705992, 23086275, 23167384, 23212523, 23359050, 24067137, 24390456, 24468836, 24495871, 25253770, 26055960, 27181063, 28108543, 28917156, 29257272, 29951132, 30301811, 30453100, 30737839, 31285539, 8641368, 8946930, 9324277		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	21387358		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	11756186, 12115363, 12200684, 12357354, 12393388, 12468433, 12750701, 12791658, 12816873, 12926083, 14504097, 14630076, 14716027, 15120929, 15178581, 15574429, 15585651, 15626738, 15769897, 15863200, 16146837, 16330434, 16410449, 16417920, 16642044, 16990784, 17145823, 17233551, 17440048, 17446348, 18068628, 18192505, 18450602, 19144992, 19181379, 19255975, 19296110, 19467916, 19557552, 19946262, 20001230, 20007803, 20035824, 20039765, 20360144, 20435347, 20548095, 20622902, 20872983, 20875872, 20966504, 21269566, 21338238, 21802138, 21868571, 21907407, 22390761, 22411868, 22469781, 22514634, 22674806, 22766221, 22911473, 23012328, 23159595, 23238897, 23340802, 23431389, 23480665, 23497317, 24085765, 24090502, 24116827, 24464319, 24608976, 24666762, 24682858, 24786392, 25155901, 25183446, 25270908, 25598437, 25662999, 25976987, 26078355, 26233683, 26299958, 26384303, 26446915, 26450903, 26547258, 26617391, 26630553, 26832846, 27132990, 27416911, 27435859, 27436336, 27465508, 27540013, 27571118, 27708062, 27748301, 27872057, 27872058, 27893163, 28108543, 28119528, 28213513, 28278729, 28421420, 28523099, 28546144, 28727840, 28863357, 28876197, 28894287, 28956923, 29285262, 29312564, 29423758, 29472720, 29544132, 29615816, 29654265, 29669779, 29843647, 30181385, 30472492, 30508668, 30651561, 30898762, 31076446, 31102119, 31103903, 31109905, 31237017, 31387917, 31470848, 31645666, 31665578, 31751472, 31756944, 31779982, 31808872, 31816063, 31834935		★☆☆☆☆ Found in Text Mining only
Acute myeloblastic leukemia with maturation	Myeloblastic Leukemia With Maturation	Orphanet			★☆☆☆☆ Found in Text Mining only
Acute myeloblastic leukemia without maturation	Myeloblastic Leukemia Without Maturation	Orphanet			★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17050201, 17184839, 19822134, 21441929, 21482694, 21928377, 22409268, 23036488, 23906301, 24526162, 25053825, 27099147, 27992414		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	18976025, 27153159		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	ORPHANET_DG	22338050		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia FAB-M6	Myeloid Leukemia	CTD_human_DG	30926971		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia with abnormal bone marrow eosinophils inv(16)(p13q22) or t(16;16)(p13;q22)	Myeloid Leukemia With Abnormal Bone Marrow Eosinophils Inv(16)(P13q22) Or T(16;16)(P13;Q22)	Orphanet			★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia with minimal differentiation	Myeloid Leukemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia with t(8;21)(q22;q22) translocation	Myeloid Leukemia With T(8;21)(Q22;Q22) Translocation	Orphanet			★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	BEFREE	12070009, 16757411		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17050201, 17184839, 19822134, 21441929, 21482694, 21928377, 22409268, 23036488, 23906301, 24526162, 25053825, 27099147, 27992414		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	ORPHANET_DG	22338050		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	ORPHANET_DG	22338050		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	26707798		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	19665070, 21813447, 29688850, 30858955		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	ORPHANET_DG	23783394		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	12060771, 12115363, 12399960, 12492581, 12515727, 12551822, 12750701, 12935959, 12973844, 15036894, 15061200, 15142116, 15889156, 16029447, 16105978, 16270043, 16619525, 16990782, 17064989, 17454189, 17606455, 19109227, 19296110, 19995225, 20096459, 20133893, 20215640, 21298367, 21387358, 21527803, 21685470, 21859732, 22126574, 22378655, 22791509, 23651981, 23816818, 24160850, 24981688, 25530565, 26707798, 26920716, 27133819, 27797250, 28125133, 29251252, 29310020, 30344754, 30575821, 30715157, 30800544, 30803552, 31515354, 31613846, 31635329, 9305596		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	12060771, 19052993		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	17454189, 24160850, 26285909		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	26603259		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	29263244		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26781266		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14504097, 14670924, 15044257, 15956279, 16116483, 16533526, 16867903, 17156841, 17205058, 19085113, 21133602, 22390761, 22705992, 23167384, 23212523, 25253770, 29951132, 30301811, 30453100, 30737839, 31285539, 8641368, 8946930, 9324277		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	10233379, 10764154, 12115363, 12750701, 12791658, 12816873, 15345593, 16051734, 16079892, 16213360, 19557552, 20548095, 20872983, 21269566, 21744003, 22129478, 22291086, 23167384, 24030729, 24090502, 25441683, 25912052, 26832846, 27132990, 27436336, 28318150, 28450419, 28523099, 28618074, 29907544, 30320942, 30737839, 31034878, 31237017		★☆☆☆☆ Found in Text Mining only
Aggressive Systemic Mastocytosis	Systemic Mastocytosis	BEFREE	28612232, 28960095		★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	16912228, 34876631	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30820040		★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	29859851	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17550846, 24314260, 35470158	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	27791036		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	8562934	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	12060771, 12515727, 19995225, 22378655, 30803552		★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12574393, 18922105		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	35876828	Associate	★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	30389549		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29278535		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	20031210, 20842730, 26923326, 28107692, 8562934		★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	26390436	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	32243411	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	35281004	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17652007		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29263244		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35381768, 35864548, 37643511, 39512680, 40696656	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	ORPHANET_DG	16234090		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32048621	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35062934	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29191878, 29752722, 31554189		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29980281, 30446465, 38327131	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	32243411	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	14504097, 14670924, 15044257, 15374878, 15956279, 16116483, 16533526, 16867903, 17156841, 17205058, 19085113, 21133602, 22390761, 22705992, 23167384, 23212523, 25253770, 29951132, 30301811, 30453100, 30737839, 31102422, 31285539, 8641368, 8946930, 9324277		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	10049058, 10233379, 11133746, 12115363, 12750701, 14504097, 15010072, 15166029, 15251987, 15345593, 16291592, 16912228, 17440048, 17763464, 18305215, 19557552, 20001230, 20413658, 20435347, 20514303, 20979630, 21967978, 22126574, 22915059, 23167384, 23740774, 24498869, 24661089, 25441683, 25662999, 26781613, 27416911, 27435859, 27571118, 28108543, 28450419, 28523099, 29090521, 29209600, 29615816, 29669779, 30737839, 31034878, 31467532, 31645648		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30590794		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23996689		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	11756186, 16867903, 17013813, 17268528, 20809224, 21233837, 22323452, 22990016, 23846442, 25456130, 27016502, 27636998		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24114287, 30118842		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24651453, 27906677, 28675510, 31782259, 33075166	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	12115363, 15179006, 19289855, 22096250, 22844482, 22915059, 23511494, 24297940, 25441683, 25529637, 29360622, 30846862, 31004014, 31807186		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26244574		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	26244574, 29859851	Associate	★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	30701458		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	24895100		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	17763464		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	18755984		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29263244		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21705501, 29025582		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	21705501, 33990705, 40474715	Associate	★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	29206716		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24936140	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	11454991		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	11454991		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	16570574		★☆☆☆☆ Found in Text Mining only
Follicular Cyst	Follicular cyst	Pubtator	31248021	Associate	★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	16570574		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	15297464	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	21171987, 31213500		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	20733134	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	25085632		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	GWASCAT_DG	30818990		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24005813		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25256166	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17522335, 24005813		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	22766221, 26351297	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	26351297, 29498106, 30576835, 31688198		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	36012751	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	8182945		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11290608, 12400596, 16761019, 18177485, 21586749, 23497317, 24269847, 26438511, 26891877, 28107692, 30320942, 31688198, 9324277		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	LHGDN	11290608		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	20849840, 23167384, 23497317, 30320942	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	11756186		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	18559972, 20581310, 23167384, 27636998, 7519507, 9324277		★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	36229877	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	18925699, 26883104	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	8562934	Stimulate	★☆☆☆☆ Found in Text Mining only
Histiocytoid hemangioma	Epithelioid hemangioma	BEFREE	29206716		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	BEFREE	18706197		★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	33681815	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	23036488	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26617391	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	18706197		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	17954572, 20035824		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	24895100		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	15329908, 15390271, 17936561, 18024405, 23115106, 28102729		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	20581310		★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10049058, 10233379, 10698507, 10720129, 11090077, 11585760, 12357354, 12399960, 12400596, 12515727, 12780793, 12842996, 12973844, 14555522, 14726387, 15105287, 15180525, 15297399, 15352981, 15604885, 15778081, 15781338, 15815726, 16015387, 16025155, 16034464, 16061630, 16146837, 16254134, 16320249, 16321862, 16410383, 16446383, 16503833, 16582613, 16585200, 16631251, 16709517, 17118759, 17205056, 17330105, 17392978, 17550846, 17652007, 17851551, 17942916, 17983653, 18071308, 18230792, 18245664, 18388181, 18394702, 18573526, 18760705, 18925699, 18977345, 19035305, 19036083, 19296110, 19541823, 19671038, 19958352, 20072157, 20515557, 20656931, 20875128, 21040219, 21114537, 21227398, 21272320, 21527514, 21552520, 21789382, 21820407, 21868571, 22201778, 22291086, 22766221, 22927251, 23340802, 23359050, 23412931, 23497317, 23727242, 23840454, 23878140, 23996689, 24030729, 24065765, 24269847, 24408321, 24468836, 24608976, 24951466, 25231999, 25280219, 25287662, 25547679, 25828893, 25957287, 26338961, 26351297, 26505133, 26547258, 27060207, 27103744, 27266526, 27300438, 27331411, 27617578, 27708062, 27838340, 28107692, 28213513, 28538663, 28748750, 28799176, 28967922, 29257272, 29343975, 29716633, 29784639, 30250637, 30262727, 30301811, 30450744, 30572745, 30596405, 30703688, 30737839, 30931863, 30944098, 31028744, 31244095, 31281512, 31688198, 8562934, 9305595, 9305596		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12351406, 12791658, 12842996, 1384791, 14504097, 14726387, 15304385, 15345597, 15374878, 15781338, 16446383, 16709517, 16902153, 17119119, 17387224, 17392978, 18024405, 18394702, 19042917, 19808698, 20875128, 21040219, 21048955, 21227398, 21520003, 21552520, 21765192, 21789382, 21868571, 21948175, 22142798, 22514634, 22911473, 23359050, 23497317, 23536721, 23733339, 23878140, 24164801, 24175822, 24786392, 25640477, 25776192, 26345285, 26438695, 26462154, 26676635, 26686245, 26819054, 27465508, 29257272, 29615816, 30450744, 30737839, 30923103, 31102119, 31606550, 31936647, 32131829, 32296014, 32409689, 32414851, 32460405, 32843624, 32898396, 33410599, 33631087, 34263728, 34641328, 34665271, 35048553, 35323440, 35794565, 36220999, 36481875, 37245251, 37591941, 37995643, 38179723, 39236794, 39408703, 40181449, 8394751, 8562934	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	14982881, 15583855, 15778081, 15797998, 16263569, 16320249, 16326981, 17936561, 17943971, 18068628, 18303245, 18925699		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35950535	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	14604973, 17379095, 17686054, 19255975, 28108543, 29257272, 30559310, 36407352, 7492767, 8896403	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10216104, 10233379, 11133746, 11369655, 11468194, 11535508, 12036858, 12070009, 12115363, 12239146, 12239147, 12351377, 12351406, 12393381, 12393388, 12417757, 12702504, 12707374, 12791658, 12816873, 12842996, 12969963, 1384791, 14504097, 14592841, 14604973, 14670924, 14726387, 14976243, 15044257, 15166029, 15178581, 15251987, 15269297, 15297464, 15304385, 15345597, 15514006, 15536149, 15574429, 15585651, 15659725, 15781338, 16076872, 16109776, 16150941, 16304372, 16368883, 16403905, 16446383, 16630339, 16757411, 16809615, 16857985, 16868253, 16902153, 16912228, 16920565, 16982329, 17047150, 17105820, 17119119, 17229632, 17379095, 17387224, 17392978, 17440048, 17456725, 17494858, 17498302, 17550846, 17650443, 17889720, 17940205, 17957027, 17965322, 18192505, 18252861, 18270328, 18305215, 18337557, 18394702, 18450602, 18450603, 18536654, 18641025, 18664261, 18809607, 18838472, 18925699, 18955790, 19016738, 19029442, 19042917, 19289855, 19389879, 19463770, 19602710, 19672946, 19775300, 19808698, 19878996, 20007803, 20119833, 20203266, 20380868, 20425795, 20514303, 20581309, 20656931, 20670134, 20678218, 20733134, 20872983, 20952518, 20966504, 20971820, 21048955, 21067588, 21127174, 21133602, 21173122, 21177505, 21242187, 21245599, 21269566, 21324374, 21338238, 21343549, 21357706, 21471285, 21520003, 21523727, 21523728, 21552520, 21577323, 21586749, 21589872, 21596848, 21606167, 21696826, 21705501, 21765192, 21767516, 21791472, 21802138, 21813447, 21816375, 21868571, 21881046, 21948175, 21967978, 21980431, 22096027, 22126574, 22208491, 22212957, 22374696, 22378655, 22417203, 22507802, 22514634, 22532519, 22535592, 22562027, 22605576, 22627678, 22684224, 22689683, 22736495, 22766221, 22800464, 22807997, 22855599, 22911473, 22912701, 22983588, 23012328, 23036488, 23115106, 23115274, 23159595, 23167384, 23233446, 23321254, 23321257, 23377000, 23377436, 23430109, 23431389, 23480665, 23497317, 23530930, 23540998, 23542687, 23613521, 23616009, 23687091, 23740774, 23763915, 23840454, 23846441, 23878140, 23940660, 23941359, 24164801, 24175822, 24227820, 24288427, 24367670, 24376688, 24441149, 24495871, 24574459, 24623852, 24666762, 24667279, 24737502, 24786392, 24855211, 24881741, 24895580, 24923295, 25022553, 25111583, 25139215, 25145343, 25239228, 25240816, 25270908, 25281355, 25381129, 25400771, 25441683, 25530214, 25573287, 25605370, 25630528, 25640477, 25706398, 25713434, 25808347, 25834112, 25879624, 25932436, 25996952, 26078355, 26091827, 26108694, 26172401, 26191952, 26212328, 26234722, 26292723, 26351297, 26365931, 26375248, 26384303, 26419938, 26438511, 26446915, 26462154, 26515730, 26547258, 26547689, 26644412, 26676635, 26681050, 26686245, 26692109, 26704388, 26755712, 26776182, 26782640, 26899600, 26929621, 27040395, 27050425, 27054578, 27058617, 27062340, 27177049, 27248172, 27315441, 27346558, 27374090, 27391351, 27416910, 27465508, 27535106, 27667292, 27671675, 27760406, 27797237, 27872057, 27872058, 27983727, 27992414, 28052408, 28061447, 28108507, 28159598, 28222251, 28294102, 28318095, 28450419, 28460451, 28473620, 28490193, 28490572, 28522571, 28574487, 28625976, 28644114, 28667329, 28727840, 28767575, 28793301, 28830460, 28851457, 28858244, 28876197, 28895560, 28945881, 28960265, 29079128, 29080039, 29227282, 29227476, 29242299, 29286103, 29304116, 29403082, 29437468, 29463564, 29498106, 29509276, 29615816, 29625580, 29643105, 29669779, 29786546, 29875101, 29976747, 30028037, 30081867, 30082223, 30102945, 30181385, 30320942, 30341082, 30389660, 30450744, 30503388, 30510164, 30521114, 30541869, 30578743, 30661740, 30728457, 30737482, 30737839, 30862120, 30862724, 30898762, 30923103, 30926971, 31009704, 31085507, 31088841, 31102119, 31112736, 31122910, 31185600, 31237017, 31310323, 31350825, 31371409, 31373163, 31434952, 31450916, 31471587, 31484791, 31515354, 31554356, 31580501, 31606550, 31648336, 31650168, 31790499, 31816063, 31826241, 31834935, 31835432, 31876540, 31919040, 31936647, 31955503, 32024878, 32040554, 32102969, 32127641, 32203582, 32216042, 32243389, 32243411, 32296014, 32304015, 32330242, 32333156, 32366841, 32384149, 32391628, 32393312, 32409689, 32476595, 32547322, 32603763, 32675227, 32697348, 32699322, 32711425, 32712325, 32732356, 32748108, 32812818, 32815753, 32843624, 32855276, 32970934, 33032648, 33049054, 33094319, 33119202, 33149230, 33217852, 33280474, 33288862, 33340276, 33351131, 33368797, 33368881, 33375770, 33410599, 33429807, 33491606, 33494808, 33592069, 33592582, 33594943, 33598693, 33631087, 33632926, 33654065, 33654204, 33681815, 33784904, 33839881, 33853292, 33876209, 33914060, 33990705, 34001134, 34024909, 34064268, 34103301, 34111285, 34168220, 34171263, 34172833, 34289175, 34299222, 34303121, 34316017, 34320781, 34348451, 34360855, 34363558, 34363960, 34417240, 34424108, 34446858, 34446939, 34459465, 34479037, 34486940, 34487021, 34487645, 34516636, 34543390, 34555701, 34602526, 34608834, 34614509, 34635505, 34665271, 34671057, 34711001, 34729939, 34811450, 34830393, 34853270, 34876631, 34889359, 34941036, 34978724, 34980040, 34981560, 34981570, 35008106, 35017466, 35048553, 35063965, 35081255, 35119307, 35130342, 35176140, 35182882, 35249471, 35323440, 35332831, 35344039, 35349331, 35350997, 35364561, 35387260, 35395091, 35412895, 35440568, 35485701, 35523692, 35549661, 35562747, 35624145, 35637252, 35666642, 35760968, 35794565, 35794567, 35797240, 35797463, 35857899, 35900493, 35922444, 35943684, 35950535, 35967966, 35981498, 35994503, 36005563, 36081495, 36165652, 36220999, 36232688, 36248800, 36259537, 36271776, 36284445, 36307762, 36315929, 36351633, 36371552, 36376378, 36407352, 36450475, 36473282, 36481875, 36485136, 36498916, 36509894, 36526260, 36542496, 36575001, 36610002, 36647792, 36738279, 36793248, 36799265, 36808479, 36823555, 36835239, 36853451, 36861732, 36881031, 36964937, 36976323, 36977512, 36977823, 37019445, 37028555, 37060505, 37067914, 37085611, 37088992, 37140277, 37147301, 37180104, 37199372, 37245251, 37272552, 37392657, 37446914, 37459200, 37480164, 37558736, 37591941, 37606693, 37640797, 37658530, 37704613, 37715270, 37830151, 37833543, 37881860, 37904054, 37935978, 37948316, 37995643, 38002257, 38056299, 38095349, 38098254, 38132393, 38179723, 38203669, 38203816, 38277619, 38324741, 38471061, 38502195, 39182032, 39236794, 39273530, 39336484, 39337490, 39348668, 39361146, 39408703, 39417441, 39875995, 40156426, 40159434, 40181449, 40226311, 40346763, 40525981, 8562934	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29257272	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	20880116, 23115106, 28102729, 30559310, 33990705, 34194582	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	18024405	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	11091200, 12115363, 12492581, 12973844, 15142116, 16029447, 16105978, 16619525, 17454189, 17456725, 17606455, 19109227, 19491417, 20133893, 20981678, 21685470, 21859732, 22378655, 22562027, 22734072, 24160850, 27063598, 27077772, 28125133, 30715157, 31292112, 32124426, 32243411, 32755558, 34077242, 34459465, 36539954, 36672788, 38095349	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	28612232		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10049058, 10192423, 10216104, 10233379, 10691863, 10698507, 10720129, 11090077, 11091200, 11133746, 11290608, 11319806, 11355923, 11442493, 11455972, 11468194, 11535508, 11585760, 11587362, 11684280, 11753604, 11753614, 11756186, 12010785, 12036858, 12070009, 12115363, 12124172, 12124173, 12200684, 12203110, 12239146, 12239147, 12351377, 12357354, 12384447, 12393388, 12393674, 12399960, 12400596, 12406902, 12447846, 12468433, 12468438, 12481903, 12492581, 12515727, 12529667, 12529668, 12531805, 12551822, 12648071, 12663439, 12681969, 12691136, 12702504, 12750701, 12759922, 12780793, 12791658, 12801839, 12815052, 12816873, 12842996, 12843001, 12854887, 12908554, 12926083, 12951584, 12969963, 1384791, 14500589, 14504097, 14562119, 14592841, 14604973, 14604974, 14630076, 14654075, 14670924, 14671635, 14716027, 14726387, 14732923, 14737077, 14976243, 14977821, 14977832, 14982881, 14984498, 15032673, 15044257, 15059064, 15105287, 15120929, 15124693, 15150124, 15158089, 15178581, 15179006, 15180525, 15242879, 15251987, 15257941, 15269297, 15289019, 15297399, 15329908, 15339674, 15345593, 15345597, 15362364, 15384974, 15498859, 15514006, 15574429, 15585651, 15604885, 15606546, 15626738, 15645287, 15650056, 15659725, 15667533, 15667534, 15674343, 15710585, 15746041, 15769897, 15781338, 15797998, 15815726, 15863200, 15889156, 15921390, 15921740, 15959528, 15973451, 15976757, 15978940, 15996732, 16015387, 16033847, 16038735, 16076867, 16079892, 16104873, 16109776, 16115128, 16116483, 16146837, 16146838, 16146839, 16150941, 16184177, 16213360, 16250847, 16266907, 16266983, 16271760, 16281072, 16304046, 16320249, 16321848, 16321862, 16330434, 16368883, 16410383, 16410449, 16418499, 16424869, 16446383, 16503833, 16573742, 16582613, 16585161, 16585200, 16594743, 16598313, 16627759, 16642044, 16757411, 16787503, 16789903, 16809615, 16854049, 16857985, 16867903, 16868253, 16869825, 16902153, 16912228, 16982329, 16990784, 17050201, 17066094, 17076533, 17105820, 17124058, 17128418, 17142856, 17145823, 17156841, 17169805, 17169806, 17205056, 17222748, 17233551, 17315232, 17330105, 17346144, 17359372, 17379095, 17392978, 17440048, 17446348, 17456725, 17485549, 17498302, 17550846, 17579862, 17598835, 17620426, 17768124, 17851551, 17851558, 17889720, 17943175, 17957027, 17960382, 18067018, 18068625, 18068628, 18071308, 18081718, 18184863, 18187662, 18192111, 18192505, 18230792, 18245664, 18252861, 18264136, 18270328, 18305215, 18336585, 18341639, 18343790, 18373709, 18394702, 18450602, 18450603, 18452069, 18467025, 18503825, 18537976, 18556063, 18573526, 18603563, 18668134, 18691757, 18692684, 18760705, 18809607, 18925699, 18955790, 18976025, 18977345, 19029442, 19036083, 19042917, 19064725, 19144992, 19162530, 19181379, 19183186, 19204327, 19255975, 19276253, 19289855, 19296110, 19389879, 19398719, 19438505, 19466291, 19467916, 19491417, 19540337, 19549778, 19557552, 19602710, 19643984, 19665070, 19671038, 19672946, 19684517, 19770377, 19808698, 19853583, 19878996, 19934300, 19946262, 19995225, 20001230, 20007803, 20035824, 20039765, 20066533, 20111072, 20119833, 20145167, 20148885, 20159992, 20172040, 20193963, 20203261, 20203266, 20233657, 20354824, 20360144, 20370649, 20380868, 20404136, 20425418, 20425795, 20435347, 20514303, 20515557, 20548095, 20567020, 20571062, 20581309, 20622902, 20651067, 20670134, 20678218, 20733134, 20803351, 20805748, 20807780, 20807885, 20809224, 20842730, 20872983, 20875872, 20884804, 20966504, 20971820, 21067588, 21082990, 21114537, 21130412, 21133602, 21156247, 21173125, 21242187, 21245757, 21262971, 21269566, 21270442, 21288478, 21319142, 21324374, 21332708, 21338238, 21339757, 21357706, 21359601, 21360050, 21387358, 21417961, 21453545, 21504297, 21520003, 21523727, 21523728, 21537333, 21546568, 21552520, 21586749, 21596848, 21606167, 21621842, 21674859, 21689085, 21690555, 21765192, 21767516, 21791472, 21791474, 21802138, 21816375, 21848891, 21860418, 21868571, 21881046, 21895538, 21907407, 21928377, 21942328, 21948175, 21967978, 21980431, 22035378, 22053959, 22117966, 22126574, 22129478, 22150087, 22208491, 22212957, 22289926, 22291086, 22318449, 22323452, 22338050, 22354205, 22368270, 22371011, 22374696, 22390761, 22409268, 22411868, 22438257, 22458420, 22469781, 22504184, 22507776, 22507802, 22514634, 22532519, 22571758, 22605576, 22614177, 22627678, 22674490, 22674806, 22681934, 22684224, 22721497, 22733614, 22736495, 22766221, 22791509, 22797303, 22800464, 22807997, 22844482, 22855599, 22885519, 22906848, 22911473, 22914610, 22927251, 22934770, 22942377, 23012328, 23017497, 23043539, 23103841, 23115106, 23115274, 23127761, 23135354, 23150981, 23154527, 23159595, 23167317, 23167384, 23238897, 23246379, 23263202, 23268332, 23276395, 23311414, 23321254, 23327922, 23340802, 23370424, 23377000, 23377436, 23385863, 23412931, 23430109, 23431389, 23437141, 23473998, 23480665, 23493348, 23496932, 23497317, 23497456, 23530930, 23538898, 23548639, 23613268, 23613521, 23616009, 23631653, 23632886, 23687091, 23701943, 23713453, 23763915, 23798029, 23840454, 23846441, 23846442, 23906301, 23929599, 23940660, 23941109, 23943874, 23969938, 23978944, 23982172, 24002496, 24030729, 24046014, 24054719, 24056683, 24070241, 24085765, 24090502, 24103301, 24116827, 24164801, 24192815, 24200998, 24282218, 24288427, 24308526, 24319184, 24408321, 24435446, 24441146, 24441149, 24464319, 24468836, 24495871, 24525236, 24526162, 24532805, 24574459, 24582753, 24591202, 24606448, 24608088, 24608976, 24619500, 24661089, 24666762, 24668492, 24682858, 24689857, 24708856, 24735609, 24737502, 24749672, 24786392, 24849514, 24855211, 24951466, 24968822, 24975213, 24981688, 25015859, 25060518, 25092144, 25111583, 25139215, 25145428, 25155901, 25183446, 25231999, 25234168, 25239228, 25240816, 25270908, 25280219, 25281355, 25287662, 25400766, 25400771, 25441683, 25456130, 25487917, 25531068, 25550214, 25573287, 25592076, 25598437, 25630528, 25640477, 25643589, 25662999, 25665465, 25679063, 25697362, 25713434, 25776192, 25795706, 25795921, 25808347, 25818407, 25826077, 25858894, 25879624, 25891481, 25896848, 25912052, 25956709, 25957287, 25971362, 25976987, 26002514, 26044548, 26046670, 26049753, 26055960, 26078355, 26081023, 26091827, 26111466, 26163606, 26206337, 26212328, 26233683, 26260140, 26286850, 26292723, 26299958, 26308771, 26384303, 26438511, 26446915, 26450903, 26462154, 26475207, 26482852, 26505133, 26515730, 26536822, 26547258, 26547689, 26551637, 26584077, 26590920, 26617391, 26630553, 26684393, 26692109, 26704388, 26739883, 26755712, 26781613, 26782640, 26785334, 26822154, 26832846, 26847745, 26848862, 26891877, 26895103, 26907662, 26999641, 27050425, 27054578, 27058617, 27099147, 27103744, 27132990, 27177049, 27266526, 27280396, 27315441, 27323399, 27331411, 27346558, 27373815, 27374090, 27400753, 27411587, 27416911, 27434660, 27435859, 27436336, 27450971, 27460866, 27465508, 27470916, 27540013, 27571118, 27617578, 27636998, 27666490, 27671675, 27708062, 27748173, 27748272, 27748301, 27748370, 27760406, 27773927, 27778197, 27791036, 27797237, 27797250, 27798920, 27833094, 27841873, 27870947, 27872057, 27872058, 27893163, 27965317, 28000291, 28001095, 28030373, 28038328, 28052408, 28061447, 28077790, 28086240, 28107692, 28108507, 28108543, 28119528, 28159598, 28194038, 28213513, 28223820, 28271164, 28276286, 28278729, 28280274, 28283965, 28301819, 28387928, 28418873, 28419965, 28421420, 28432220, 28450419, 28460451, 28470536, 28486748, 28490193, 28490572, 28516360, 28523099, 28538663, 28546144, 28574487, 28580438, 28610444, 28612232, 28616699, 28618074, 28625976, 28637883, 28644114, 28645776, 28673394, 28673395, 28710745, 28727840, 28748750, 28793301, 28799432, 28835438, 28851457, 28858244, 28863357, 28876197, 28881711, 28893624, 28894287, 28895560, 28912176, 28914261, 28923853, 28947392, 28956923, 28960095, 28967922, 28976600, 28980058, 29051803, 29055209, 29059168, 29069942, 29070697, 29074603, 29080039, 29090473, 29090521, 29100302, 29124948, 29139135, 29149610, 29156201, 29164965, 29172682, 29191878, 29209600, 29212189, 29227282, 29231051, 29262547, 29263244, 29278535, 29283906, 29285262, 29285788, 29286055, 29286103, 29304116, 29310020, 29312564, 29316714, 29330746, 29339551, 29343975, 29357250, 29383835, 29403082, 29409989, 29423758, 29431743, 29432313, 29437468, 29463558, 29463564, 29472718, 29472720, 29487059, 29487300, 29498106, 29498296, 29505696, 29507660, 29509276, 29521250, 29544132, 29558838, 29615816, 29643105, 29654265, 29663558, 29664232, 29669779, 29672049, 29682194, 29699481, 29716633, 29733074, 29744585, 29748445, 29763550, 29773601, 29773641, 29784639, 29785506, 29857559, 29859851, 29894944, 29907544, 29935772, 29950146, 29951132, 29959200, 29976747, 29983874, 29986851, 30015632, 30017192, 30028037, 30064973, 30081867, 30082225, 30102945, 30127098, 30147364, 30148617, 30181385, 30250637, 30253726, 30270754, 30303964, 30320942, 30332834, 30344940, 30372617, 30372901, 30382485, 30405611, 30410361, 30420889, 30423915, 30472492, 30503388, 30506467, 30508668, 30510164, 30514174, 30514344, 30521114, 30527920, 30537918, 30541869, 30552988, 30553002, 30555035, 30559267, 30565931, 30568173, 30578743, 30626126, 30651561, 30661740, 30681373, 30686755, 30703688, 30715157, 30715623, 30721452, 30728456, 30737482, 30737839, 30742435, 30753289, 30770553, 30800259, 30808826, 30820040, 30828789, 30858548, 30858955, 30860598, 30861214, 30862120, 30862724, 30898762, 30923103, 30926085, 30926392, 30931863, 30939008, 30942519, 30944098, 30944659, 30946869, 30947742, 30953707, 30953752, 30953928, 30975911, 30975912, 31009704, 31034878, 31069015, 31076446, 31088841, 31102119, 31103903, 31109905, 31112736, 31114157, 31122828, 31134509, 31149783, 31171000, 31173645, 31175001, 31203997, 31207462, 31217189, 31235852, 31237017, 31238330, 31279288, 31281512, 31285539, 31286998, 31291613, 31301319, 31302157, 31309543, 31310323, 31320594, 31336846, 31342980, 31359361, 31361136, 31371322, 31385001, 31387917, 31432396, 31434952, 31454267, 31462456, 31466809, 31469910, 31470848, 31471587, 31473943, 31479709, 31484791, 31515354, 31515455, 31533545, 31548092, 31550496, 31559849, 31572552, 31580501, 31591496, 31614258, 31619996, 31632141, 31645666, 31648336, 31650162, 31650168, 31665578, 31669649, 31670517, 31682240, 31688198, 31692922, 31700594, 31718075, 31721578, 31730602, 31751472, 31752581, 31756575, 31756944, 31762943, 31779982, 31807186, 31808857, 31808872, 31816063, 31817795, 31819100, 31821677, 31826241, 31834935, 31848884, 8562934, 8916965, 8946930, 9305595, 9305596, 9324277, 9737679		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CLINVAR_DG	11290608, 14604974, 14737077, 15256420, 15374878, 15625552, 15667533, 15863200, 16091740, 16371029, 16410449, 16573742, 16857985, 16990784, 17047150, 17606455, 17889720, 19657110, 19840437, 20733134, 22368270, 22504183, 22504184, 22504185, 22504186, 23261068, 23321257, 23430109, 23714533, 23783394, 23878140, 24046014, 24619500, 25157968		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	12036858, 12070009, 12239146, 12239147, 12816873, 12926083, 14562119, 14630076, 14654525, 14737077, 14977832, 15054042, 15166029, 15167911, 15921740, 15978940, 16368883, 16502586, 16990784, 16990788, 17105820, 17456725, 17485549, 17851551, 17940205, 17965322, 17983653, 18081718, 18343790, 18473998, 18490735, 18503825, 18605083, 18670883, 18955790, 18977345		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17050201, 17184839, 19822134, 21441929, 21482694, 21928377, 22409268, 23036488, 23906301, 24526162, 25053825, 27099147, 27992414		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Leukemia, Myeloid, Chronic, Atypical, BCR-ABL Negative	Myeloid Leukemia	BEFREE	17764812		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	15329908, 17936561, 23115106, 23690417, 28102729		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	19667267, 26244574		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31391334		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	29859851	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27590507		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31713298	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	29843647	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	1384791, 15604885, 23359050, 27181063, 8562934		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21705501, 33990705, 40474715, 40533930	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31688198		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	21227398		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	9324277		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29263244		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29191878, 29752722, 31554189		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12120238, 17676584, 30275197		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28674082		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29263244		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	16570574		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10049058, 10233379, 11585760, 12951584, 15010072, 15390271, 15710585, 16116483, 16275934, 16570574, 17698633, 17940205, 18024405, 18068625, 18071308, 18663058, 18668305, 19540337, 20026798, 20143449, 20656931, 21387358, 22514634, 23043539, 23268332, 23300935, 23613268, 23748345, 23940660, 25060518, 26630553, 26920889, 27016502, 27315441, 28420414, 28440315, 28461409, 28960265, 29203143, 29257272, 29421713, 29699481, 30135222, 30148617, 31309543, 31408808, 31515354		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20360144		★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	17229632, 18663058, 23497317	Associate	★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	12801532, 18663058, 28612232, 28960095, 29051803, 29343975, 29487059, 30148617, 30753289, 31309543, 31730602		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29494692		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35300397	Associate	★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	14732923, 16787503, 16902153, 19279329, 26547258, 30555035		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28420414	Associate	★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	ORPHANET_DG	26276768, 27069254, 29072953		★☆☆☆☆ Found in Text Mining only
Mixed phenotype acute leukemia	Mixed Phenotype Leukemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	28727816		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	30820040		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28727816, 9324277		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	17620055	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	15178581, 24441146, 24903747, 9305595		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10233379, 10697556, 12357354, 12529667, 14654075, 14732923, 14737077, 15036894, 15178581, 15257941, 15329908, 15345597, 15996732, 16417920, 16787503, 16902153, 17050076, 17079011, 17156841, 17169806, 17550846, 18467025, 18503825, 19274612, 19276253, 19279329, 20222800, 21173125, 21233837, 22096250, 22323452, 23115106, 24441146, 24903747, 26547258, 27741277, 28486748, 30555035, 9305595, 9324277, 9737679		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	14737077, 18067020, 18503825, 18670883		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	15329908, 16787503, 16902153, 20678218, 20733134, 22571758, 23115106, 25530214, 26004809, 26547258, 27741277, 27992414, 28318095, 32476595, 32675227, 33275714, 33558656, 33990705, 34111285, 36380727	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic-Myeloproliferative Diseases	Myelodysplastic-Myeloproliferative Diseases	BEFREE	23846442		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29235894, 30001163		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12393674		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1384791, 16320249, 21527514, 22289926, 22643831, 27300438, 28107692		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10233379, 12908554, 14976243, 17124058, 18467025, 18925699, 20809224, 23796006, 23846442, 24144310, 26049753, 28107692, 29100302, 9324277		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	11756186, 12060771, 16116483, 16627759, 16867903, 17268528, 17936561, 18245664, 18663058, 22323452, 22438257, 22517899, 22990016, 23497317, 23846442, 24525236, 25456130, 27016502, 28432220, 30420889, 31670517		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10738251, 12531805, 15352981, 16038735, 18202801, 19143470, 19541823, 21360050, 21705501, 21928377, 22117966, 22990016, 22996231, 24114287, 24408321, 24495871, 26438511, 26482852, 26895103, 27906677, 28163010, 28271164, 28516360, 29025582, 29051803, 29257272, 29263244, 29794225, 30135222, 30862120, 30862724, 31235865		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	19171881, 19536888, 21659357, 21942328, 22895555, 23542687, 23979985, 26499507, 28159598, 28163010, 30082223, 30450160		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11454991, 17941064, 20924716		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36037157, 37219000	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	11454991		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	26244574		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	26244574, 29859851	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	10590052	Associate	★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	16570574		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29263244		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31515354		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31515354	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30820040		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31129149	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12120238, 17676584, 30275197		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	16570574, 30514174		★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	Pubtator	24881741	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	27906677	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	26811494	Associate	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	BEFREE	23359050		★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	CTD_human_DG	27099147, 27725143		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	22411871		★☆☆☆☆ Found in Text Mining only
Posterior reversible encephalopathy syndrome	Leukoencephalopathy	BEFREE	26907662		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	30860598		★☆☆☆☆ Found in Text Mining only
Precursor B-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	10914546, 21474181, 21552520, 31817795		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	ORPHANET_DG	16234090		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	8182945		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	14604973, 15604885, 17942916, 18925699, 21272320, 22049994, 22705992, 23086275, 23359050, 24067137, 24390456, 24468836, 24495871, 26055960, 27181063, 28108543, 28917156, 29257272, 31285539		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	14670924, 15044257, 15604885, 17584026, 17881645, 17910045		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor T-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	15044257, 17943971, 21527514, 22261446, 22751451, 26172269, 26852660		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	ORPHANET_DG	16234090		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	12580961, 29235894, 30001163		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28674082		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27701467	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24895100		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychomotor Agitation	Psychiatric disorders	Pubtator	32243411	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31076499		★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	17550846		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	15329908		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26244574		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	28125133	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31066629		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	19036083, 26297285		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	27642091	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	35876828	Associate	★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	12551822, 17550846, 20525753, 21233837, 22084373, 22197676, 22736495, 24297940, 27983727, 27992414, 30555035, 31766013		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	32243411	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	29859851	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35705251	Associate	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	23687091	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30005849		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	37390276	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32048621	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29263244		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26811494	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	23687091, 25630528, 34417240	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	17013813	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	29859851	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	31248021	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	32411094	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16570574	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	16570574		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	16570574		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16570574		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	16570574	Associate	★☆☆☆☆ Found in Text Mining only
Torsades de Pointes	Torsades de pointes	Pubtator	29859851	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	33462189, 35354918, 36674940	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Turner Syndrome	Turner syndrome	Pubtator	36733527	Associate	★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	27018948	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	21269566	Associate	★☆☆☆☆ Found in Text Mining only