FITM1 (fat storage inducing transmembrane protein 1) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	161247
Gene name	Fat storage inducing transmembrane protein 1
Gene symbol	FITM1
Synonyms (NCBI Gene)	FIT1
Chromosome	14
Chromosome location	14q12
Summary	FIT1 belongs to an evolutionarily conserved family of proteins involved in fat storage (Kadereit et al., 2008 [PubMed 18160536]).[supplied by OMIM, May 2008]

24 Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS	18160536
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0008654	Process	Phospholipid biosynthetic process	IBA
GO:0008654	Process	Phospholipid biosynthetic process	IEA
GO:0010945	Function	Coenzyme A diphosphatase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0017129	Function	Triglyceride binding	IEA
GO:0017129	Function	Triglyceride binding	ISS
GO:0019915	Process	Lipid storage	IBA
GO:0019915	Process	Lipid storage	IEA
GO:0019992	Function	Diacylglycerol binding	IEA
GO:0019992	Function	Diacylglycerol binding	ISS
GO:0034389	Process	Lipid droplet organization	IBA
GO:0034389	Process	Lipid droplet organization	IEA
GO:0034389	Process	Lipid droplet organization	ISS	18160536
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS	18160536
GO:0140042	Process	Lipid droplet formation	IEA
GO:0140042	Process	Lipid droplet formation	ISS

MIM	HGNC	e!Ensembl
612028	33714	ENSG00000139914

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	A5D6W6
Protein name	Fat storage-inducing transmembrane protein 1 (Fat-inducing protein 1)
Protein function	Plays an important role in the formation of lipid droplets (LDs) which are storage organelles at the center of lipid and energy homeostasis (By similarity) (PubMed:18160536). Directly binds to diacylglycerol (DAGs) and triacylglycerol (By simila
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Primarily expressed in heart and skeletal muscle. {ECO:0000269\|PubMed:18160536}.
Sequence	MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWL AAVVIFGPLLQFHVNPRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAV TARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRG YTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTV IYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKHN
Sequence length	292
Interactions	View interactions

Reactome Pathway
Lipid particle organization