FER (FER tyrosine kinase)

Gene

• Entrez ID: 2241
• Gene name: FER tyrosine kinase
• Gene symbol: FER
• Synonyms (NCBI Gene): PPP1R74, TYK3, p94-Fer
• Chromosome: 5
• Chromosome location: 5q21.3
• Summary: The protein encoded by this gene is a member of the FPS/FES family of non-transmembrane receptor tyrosine kinases. It regulates cell-cell adhesion and mediates signaling from the cell surface to the cytoskeleton via growth factor receptors. Alternative sp

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051027	hsa-miR-17-5p	CLASH	23622248
MIRT050063	hsa-miR-26a-5p	CLASH	23622248
MIRT038279	hsa-miR-26a-2-3p	CLASH	23622248
MIRT626663	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT626662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT626661	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT626660	hsa-miR-4469	HITS-CLIP	23824327
MIRT626659	hsa-miR-4326	HITS-CLIP	23824327
MIRT626658	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT626657	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT626656	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT626655	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT626654	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT626653	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT626652	hsa-miR-218-1-3p	HITS-CLIP	23824327
MIRT626651	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT626650	hsa-miR-507	HITS-CLIP	23824327
MIRT626649	hsa-miR-557	HITS-CLIP	23824327
MIRT626648	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT626663	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT648989	hsa-miR-4686	HITS-CLIP	23824327
MIRT626662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT626661	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT626660	hsa-miR-4469	HITS-CLIP	23824327
MIRT648988	hsa-miR-93-3p	HITS-CLIP	23824327
MIRT648987	hsa-miR-3692-5p	HITS-CLIP	23824327
MIRT648986	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT626659	hsa-miR-4326	HITS-CLIP	23824327
MIRT626658	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT626657	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT626656	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT626655	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT648985	hsa-miR-6071	HITS-CLIP	23824327
MIRT626654	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT626653	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT626652	hsa-miR-218-1-3p	HITS-CLIP	23824327
MIRT626651	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT626650	hsa-miR-507	HITS-CLIP	23824327
MIRT626649	hsa-miR-557	HITS-CLIP	23824327
MIRT626648	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT626663	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT626662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT626661	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT626660	hsa-miR-4469	HITS-CLIP	23824327
MIRT626659	hsa-miR-4326	HITS-CLIP	23824327
MIRT626658	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT626657	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT626656	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT626655	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT626654	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT626653	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT626652	hsa-miR-218-1-3p	HITS-CLIP	23824327
MIRT626651	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT626650	hsa-miR-507	HITS-CLIP	23824327
MIRT626649	hsa-miR-557	HITS-CLIP	23824327
MIRT626648	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT447435	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT447434	hsa-miR-5011-5p	PAR-CLIP	22100165
MIRT447433	hsa-miR-4635	PAR-CLIP	22100165
MIRT447432	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT447431	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT447436	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT447435	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT447434	hsa-miR-5011-5p	PAR-CLIP	22100165
MIRT447433	hsa-miR-4635	PAR-CLIP	22100165
MIRT447432	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT447431	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT626663	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT626662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT626661	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT626660	hsa-miR-4469	HITS-CLIP	23824327
MIRT626659	hsa-miR-4326	HITS-CLIP	23824327
MIRT626658	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT626657	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT626656	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT626655	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT626654	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT626653	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT626652	hsa-miR-218-1-3p	HITS-CLIP	23824327
MIRT626651	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT626650	hsa-miR-507	HITS-CLIP	23824327
MIRT626649	hsa-miR-557	HITS-CLIP	23824327
MIRT626648	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT626663	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT648989	hsa-miR-4686	HITS-CLIP	23824327
MIRT626662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT626661	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT626660	hsa-miR-4469	HITS-CLIP	23824327
MIRT648988	hsa-miR-93-3p	HITS-CLIP	23824327
MIRT648987	hsa-miR-3692-5p	HITS-CLIP	23824327
MIRT648986	hsa-miR-6882-3p	HITS-CLIP	23824327
MIRT626659	hsa-miR-4326	HITS-CLIP	23824327
MIRT626658	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT626657	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT626656	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT626655	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT648985	hsa-miR-6071	HITS-CLIP	23824327
MIRT626654	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT626653	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT626652	hsa-miR-218-1-3p	HITS-CLIP	23824327
MIRT626651	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT626650	hsa-miR-507	HITS-CLIP	23824327
MIRT626649	hsa-miR-557	HITS-CLIP	23824327
MIRT626648	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT626663	hsa-miR-582-3p	HITS-CLIP	23824327
MIRT626662	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT626661	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT626660	hsa-miR-4469	HITS-CLIP	23824327
MIRT626659	hsa-miR-4326	HITS-CLIP	23824327
MIRT626658	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT626657	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT626656	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT626655	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT626654	hsa-miR-33a-5p	HITS-CLIP	23824327
MIRT626653	hsa-miR-33b-5p	HITS-CLIP	23824327
MIRT626652	hsa-miR-218-1-3p	HITS-CLIP	23824327
MIRT626651	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT626650	hsa-miR-507	HITS-CLIP	23824327
MIRT626649	hsa-miR-557	HITS-CLIP	23824327
MIRT626648	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT447435	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT447434	hsa-miR-5011-5p	PAR-CLIP	22100165
MIRT447433	hsa-miR-4635	PAR-CLIP	22100165
MIRT447432	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT447431	hsa-miR-5585-3p	PAR-CLIP	22100165
MIRT447436	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT447435	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT447434	hsa-miR-5011-5p	PAR-CLIP	22100165
MIRT447433	hsa-miR-4635	PAR-CLIP	22100165
MIRT447432	hsa-miR-190a-3p	PAR-CLIP	22100165
MIRT447431	hsa-miR-5585-3p	PAR-CLIP	22100165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IMP	12972546
GO:0000785	Component	Chromatin	IDA	1990274
GO:0001932	Process	Regulation of protein phosphorylation	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	IBA
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS	2725517
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IDA	12972546, 19738202
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005154	Function	Epidermal growth factor receptor binding	IDA	21518868
GO:0005515	Function	Protein binding	IPI	15226396, 22939624, 25036637, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	19147545
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	1990274
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005912	Component	Adherens junction	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006468	Process	Protein phosphorylation	TAS	2725517
GO:0006935	Process	Chemotaxis	IBA
GO:0006935	Process	Chemotaxis	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IDA	19147545
GO:0007281	Process	Germ cell development	IEA
GO:0008157	Function	Protein phosphatase 1 binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	25540073
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	20111072
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0008289	Function	Lipid binding	IDA	19738202
GO:0008289	Function	Lipid binding	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	19738202
GO:0010591	Process	Regulation of lamellipodium assembly	IDA	19738202
GO:0010762	Process	Regulation of fibroblast migration	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	19738202
GO:0015630	Component	Microtubule cytoskeleton	IDA	12972546
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	12972546, 19738202
GO:0019221	Process	Cytokine-mediated signaling pathway	IMP	9722593
GO:0030027	Component	Lamellipodium	IDA	19738202
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030054	Component	Cell junction	IDA	12972546
GO:0030335	Process	Positive regulation of cell migration	IMP	19738202
GO:0030838	Process	Positive regulation of actin filament polymerization	IMP	19738202
GO:0032273	Process	Positive regulation of protein polymerization	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0033007	Process	Negative regulation of mast cell activation involved in immune response	IEA
GO:0033007	Process	Negative regulation of mast cell activation involved in immune response	ISS
GO:0034333	Process	Adherens junction assembly	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	ISS
GO:0034614	Process	Cellular response to reactive oxygen species	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	ISS
GO:0035426	Process	Extracellular matrix-cell signaling	IEA
GO:0035426	Process	Extracellular matrix-cell signaling	ISS
GO:0035556	Process	Intracellular signal transduction	TAS	2209086
GO:0036006	Process	Cellular response to macrophage colony-stimulating factor stimulus	IMP	9722593
GO:0036119	Process	Response to platelet-derived growth factor	IEA
GO:0036119	Process	Response to platelet-derived growth factor	ISS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IBA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	ISS
GO:0038109	Process	Kit signaling pathway	IEA
GO:0038109	Process	Kit signaling pathway	ISS
GO:0042058	Process	Regulation of epidermal growth factor receptor signaling pathway	IMP	21518868
GO:0042995	Component	Cell projection	IEA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IEA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	ISS
GO:0046777	Process	Protein autophosphorylation	IDA	7623846
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	ISS
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	TAS	11994747
GO:0050904	Process	Diapedesis	IEA
GO:0050904	Process	Diapedesis	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	21518868
GO:0051495	Process	Positive regulation of cytoskeleton organization	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060009	Process	Sertoli cell development	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	19147545
GO:0070161	Component	Anchoring junction	IEA
GO:0072520	Process	Seminiferous tubule development	IEA
GO:0120035	Process	Regulation of plasma membrane bounded cell projection organization	IEA
GO:0120179	Process	Adherens junction disassembly	IEA
GO:1902905	Process	Positive regulation of supramolecular fiber organization	IEA

Other IDs

• MIM: 176942
• HGNC: 3655
• e!Ensembl: ENSG00000151422

Protein

• UniProt ID: P16591
• Protein name: Tyrosine-protein kinase Fer (EC 2.7.10.2) (Feline encephalitis virus-related kinase FER) (Fujinami poultry sarcoma/Feline sarcoma-related protein Fer) (Proto-oncogene c-Fer) (Tyrosine kinase 3) (p94-Fer)
• Protein function: Tyrosine-protein kinase that acts downstream of cell surface receptors for growth factors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, lamellipodia formation, cell adhesion, cell migration and chemotaxis. A
• PDB: 2KK6, 6KC4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00611	FCH	10 → 87	Fes/CIP4, and EFC/F-BAR homology domain	Family
  PF00017	SH2	460 → 531	SH2 domain	Domain
  PF07714	PK_Tyr_Ser-Thr	563 → 814	Protein tyrosine and serine/threonine kinase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is detected in normal colon and in fibroblasts (at protein level). Isoform 3 is detected in normal testis, in colon carcinoma-derived metastases in lung, liver and ovary, and in colon carcinoma and hepato carcinoma cell lines
• Sequence:

  MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQ
  MNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQ
  IEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHM
  LHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEI
  VNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNL
  TAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQAL
  EELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK
  FESIRHSIAGIIRSPKSALGSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDF
  LVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITK
  KSGVVLLNPIPKDKKWILSHEDVILGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQE
  LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVSGGDFLTFLRRKKDELKLKQ
  LVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGLK
  QIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMS
  APQHCPEDISKIMMKCWDYKPENRPKFSELQKELTIIKRKLT

• Sequence length: 822

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Duane retraction syndrome	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DUPUYTREN CONTRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY TRACT INFECTIOUS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	18336585		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19129484		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23699534		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	9490301		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19129484		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31404611		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	27611488		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	GWASDB_DG	22935194		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35385742	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19835603	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23573306, 28245430		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31404611	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23445469	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28471688		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19129484		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33430475	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11300220		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness, Autosomal Recessive 9	Deafness	BEFREE	10995573		★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23092343		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28245430		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28245430		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33430475	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29634284		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12039914		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17361223, 20111072, 21114537		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19835603, 28245430, 28459452		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28245430		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23573306	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28245430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23573306, 28245430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31404611		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19147545, 23906537, 28245430, 28459452		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23573306, 23931849, 29396402		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	11300220		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17174104, 23589302, 28245430, 30839983		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23573306, 23699534, 23931849		★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	10995573		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29099290, 29920310, 37196766	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31404611		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31404611	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27297792, 30217447		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10687853, 19147545, 23906537, 28245430, 28459452		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19147545		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19147545, 25238935, 34417538	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28851893		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	26297285		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	25533491, 28851893		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21097718	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35385742	Associate	★☆☆☆☆ Found in Text Mining only