FCGR1BP (Fc gamma receptor Ib, pseudogene)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 2210
• Gene name: Fc gamma receptor Ib, pseudogene
• Gene symbol: FCGR1BP
• Synonyms (NCBI Gene): CD34, CD64b, FCG1, FCGR1, FCGR1B, FcRI, FcgammaRIa, IGFR1, IGFRB
• Chromosome: 1
• Chromosome location: 1p11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029614	hsa-miR-26b-5p	Microarray	19088304
MIRT993843	hsa-miR-3658	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001788	Process	Antibody-dependent cellular cytotoxicity	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	1430234
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	NAS	1430234
GO:0007166	Process	Cell surface receptor signaling pathway	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0019763	Function	Immunoglobulin receptor activity	NAS	1430234
GO:0019770	Function	IgG receptor activity	IBA
GO:0019864	Function	IgG binding	IBA
GO:0019864	Function	IgG binding	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031901	Component	Early endosome membrane	TAS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IBA
GO:0038093	Process	Fc receptor signaling pathway	IEA
GO:0038094	Process	Fc-gamma receptor signaling pathway	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IBA

Other IDs

• MIM: 601502
• HGNC: 3614
• e!Ensembl: ENSG00000291135

Protein

• UniProt ID: Q92637
• Protein name: Putative high affinity immunoglobulin gamma Fc receptor IB (IgG Fc receptor IB) (Fc gamma receptor IB pseudogene) (Fc-gamma RIB) (FcRIB) (hFcgammaRIB)
• Protein function: May bind to the Fc region of immunoglobulins gamma with a low affinity compared to FCGR1A. May function in the humoral immune response.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13895	Ig_2	104 → 186	Immunoglobulin domain	Domain
  PF13927	Ig_3	23 → 87		Domain

• Sequence:

  MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
  TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFMEGEPL
  ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
  ISQYTVKGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWNLEISLDSGHE
  KKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT

• Sequence length: 280

Pathways

Reactome Pathway

Cross-presentation of soluble exogenous antigens (endosomes)

Interferon gamma signaling

Related Genes

No strongly related genes found yet for FCGR1BP.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FCGR1BP.