FBXW9 (F-box and WD repeat domain containing 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 84261
Gene name F-box and WD repeat domain containing 9
Gene symbol FBXW9
Synonyms (NCBI Gene)
Fbw9MEC-15
Chromosome 19
Chromosome location 19p13.13
Summary Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box pro
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1994707 hsa-miR-361-3p CLIP-seq
MIRT1994708 hsa-miR-4773 CLIP-seq
MIRT1994709 hsa-miR-548aa CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19159283, 27705803, 33961781
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
609074 28136 ENSG00000132004
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5XUX1
Protein name F-box/WD repeat-containing protein 9 (F-box and WD-40 domain-containing protein 9)
Protein function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 213 → 252 WD domain, G-beta repeat Repeat
PF00400 WD40 165 → 201 WD domain, G-beta repeat Repeat
PF12937 F-box-like 79 → 126 F-box-like Domain
Sequence 
MELPLGRCDDSRTWDDDSDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAASP
SASEPRAASRVSAVSEPGLLSLPPELLLEICSYLDARLVLHVLSRVCHALRDLVSDHVTW
RLRALRRVRAPYPVVEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVL
LLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLIKTLGTKRNSTHEGWVWSLAAQDHRVC
SGSWDSTVKLWDMAADGQQFGEIKASSAVLCLSYLPDILVTGTYDKKVTIYDPRAGPALL
KHQQLHSRPVLTLLADDRHIISGSEDHTLVVVDRRANSVLQRLQLDSYLLCMSYQEPQLW
AGDNQGLLHVFANRNGCFQLIRSFDVGHSFPITGIQYSVGALYTTSTDKTIRVHVPTDPP
RTICTRRHDNGLNRVCAEGNLVVAGSGDLSLEVWRLQA
Sequence length 458
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Neddylation
Antigen processing: Ubiquitination & Proteasome degradation

No strongly related genes found yet for FBXW9.

No additional diseases found yet through genes similar to FBXW9.