FBXW10B (F-box and WD repeat domain containing 10B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 374286
Gene name F-box and WD repeat domain containing 10B
Gene symbol FBXW10B
Synonyms (NCBI Gene)
C170RF1C17ORF1C17ORF1ACDRT1FBXW10P1HREPSM25H2
Chromosome 17
Chromosome location 17p12
miRNA miRNA information provided by mirtarbase database.
12 Show/Hide all (12)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1961397 hsa-miR-1270 CLIP-seq
MIRT1961398 hsa-miR-143 CLIP-seq
MIRT1961399 hsa-miR-148a CLIP-seq
MIRT1961400 hsa-miR-148b CLIP-seq
MIRT1961401 hsa-miR-152 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005575 Component Cellular_component ND
GO:0008150 Process Biological_process ND
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604596 14379 ENSG00000241322
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95170
Protein name F-box and WD repeat domain containing protein 10B (CMT1A duplicated region transcript 1 protein)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 485 → 521 WD domain, G-beta repeat Repeat
PF00400 WD40 445 → 481 WD domain, G-beta repeat Repeat
PF00400 WD40 564 → 600 WD domain, G-beta repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in pancreas, heart and skeletal muscle. {ECO:0000269|PubMed:11381029, ECO:0000269|PubMed:9403059}.
Sequence 
MENLESRLKNAPYFRCEKGTDSIPLCRKCETRVLAWKIFSTKEWFCRINDISQRRFLVGI
LKQLNSLYLLHYFQNILQTTQGKDFIYNRSRIDLSKKEGKVVKSSLNQMLDKTVEQKMKE
ILYWFANSTQWTKANYTLLLLQMCNPKLLLTAANVIRVLFLREENNISGLNQDITDVCFS
PEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHFLGAASNPEEPWRNSLRCISEMNRL
FSGKADITKPGYDPCNLLVDLDDIRDLSSGFSKYRDFIRYLPIHLSKYILRMLDRHTLNK
CASVSQHWAAMAQQVKMDLSAHGFIQNQITFLQGSYTRGIDPNYANKVSIPVPKMVDDGK
SMRVKHPKWKLRTKNEYNLWTAYQNEETQQVLMEERNVFCGTYNVRILSDTWDQNRVIHY
SGGDLIAVSSNRKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYW
DLKSGVCTRIFGGHQGTITCMDLCKNRLVSGGRDCQVKVWDVDTGKCLKTFRHKDPILAT
RINDTYIVSSCERGLVKVWHIAMAQLVKTLSGHEGAVKCLFFDQWHLLSGSTDGLVMAWS
MVGKYERCLMAFKHPKEVLDVSLLFLRVISACADGKIRIYNFFNGNCMKVIKANGRGDPV
LSFFIQGNRISVCHISTFAKRINVGWNGIEPSATAQGGNASLTECAHVRLHIAGHLPASR
LPVAAVQPMTGGMAPTTAPTHVLAMLILFSGV
Sequence length 752
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Malignant lymphoma, large B-cell, diffuse Benign ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Frontotemporal dementia Frontotemporal dementia BEFREE 9799091
★★★★★
★☆☆☆☆
Found in Text Mining only
Pick Disease of the Brain Pica BEFREE 9799091
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for FBXW10B.

No additional diseases found yet through genes similar to FBXW10B.