FBXO8 (F-box protein 8)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26269
• Gene name: F-box protein 8
• Gene symbol: FBXO8
• Synonyms (NCBI Gene): DC10, FBS, FBX8
• Chromosome: 4
• Chromosome location: 4q34.1
• Summary: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

miRNA Show/Hide all (50)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019812	hsa-miR-375	Microarray	20215506
MIRT031200	hsa-miR-19b-3p	Sequencing	20371350
MIRT031200	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT557911	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT557910	hsa-miR-424-3p	PAR-CLIP	21572407
MIRT557909	hsa-miR-6728-3p	PAR-CLIP	21572407
MIRT557908	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT557907	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT557906	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT557905	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT557904	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT557903	hsa-miR-3194-3p	PAR-CLIP	21572407
MIRT557902	hsa-miR-1251-3p	PAR-CLIP	21572407
MIRT557901	hsa-miR-548aw	PAR-CLIP	21572407
MIRT557900	hsa-miR-2113	PAR-CLIP	21572407
MIRT031200	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT557911	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT557910	hsa-miR-424-3p	PAR-CLIP	21572407
MIRT557909	hsa-miR-6728-3p	PAR-CLIP	21572407
MIRT557908	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT557907	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT557906	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT557905	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT557904	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT557903	hsa-miR-3194-3p	PAR-CLIP	21572407
MIRT557902	hsa-miR-1251-3p	PAR-CLIP	21572407
MIRT557901	hsa-miR-548aw	PAR-CLIP	21572407
MIRT557900	hsa-miR-2113	PAR-CLIP	21572407
MIRT2228516	hsa-miR-19a	CLIP-seq
MIRT2228517	hsa-miR-19b	CLIP-seq
MIRT2228518	hsa-miR-3152-3p	CLIP-seq
MIRT2228519	hsa-miR-4328	CLIP-seq
MIRT2228520	hsa-miR-548ae	CLIP-seq
MIRT2228521	hsa-miR-548aj	CLIP-seq
MIRT2228522	hsa-miR-548am	CLIP-seq
MIRT2228523	hsa-miR-548x	CLIP-seq
MIRT2228524	hsa-miR-760	CLIP-seq
MIRT2228519	hsa-miR-4328	CLIP-seq
MIRT2532280	hsa-miR-3148	CLIP-seq
MIRT2532281	hsa-miR-4668-3p	CLIP-seq
MIRT2228520	hsa-miR-548ae	CLIP-seq
MIRT2228521	hsa-miR-548aj	CLIP-seq
MIRT2228522	hsa-miR-548am	CLIP-seq
MIRT2228523	hsa-miR-548x	CLIP-seq
MIRT2532280	hsa-miR-3148	CLIP-seq
MIRT2532281	hsa-miR-4668-3p	CLIP-seq
MIRT2228520	hsa-miR-548ae	CLIP-seq
MIRT2228521	hsa-miR-548aj	CLIP-seq
MIRT2228522	hsa-miR-548am	CLIP-seq
MIRT2228523	hsa-miR-548x	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0000151	Component	Ubiquitin ligase complex	NAS	10945468
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005515	Function	Protein binding	IPI	31024008
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	NAS	10945468
GO:0032012	Process	Regulation of ARF protein signal transduction	IEA

Other IDs

• MIM: 605649
• HGNC: 13587
• e!Ensembl: ENSG00000164117

Protein

• UniProt ID: Q9NRD0
• Protein name: F-box only protein 8 (F-box/SEC7 protein FBS)
• Protein function: May promote guanine-nucleotide exchange on an ARF. Promotes the activation of ARF through replacement of GDP with GTP (Potential).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01369	Sec7	136 → 313	Sec7 domain	Domain

• Sequence:

  MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKAR
  KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
  IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
  NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
  RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
  EDFVGHLYDNIYLIGHVAA

• Sequence length: 319

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (9)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (41)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30891164		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31726193		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18338817, 29293622		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31726193		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25435410, 27268613		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21372829		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21372829		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30324578		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27916606, 31024008		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28151034, 31486697		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29742131		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	34659254	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29340105, 29365333, 29491638		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30572719		★☆☆☆☆ Found in Text Mining only
Fanconi-Bickel Syndrome	Fanconi-Bickel Syndrome	BEFREE	27527641, 28523479		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25550853	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28592121		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31708005		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29340105, 31708005		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26276873		★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	23436191		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24741612	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24741612	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24741612		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23826080, 29491644, 31724462		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25435410, 27268613		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21372829		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17418805, 21557276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25801334		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25801334, 29455394, 31024008, 31724462, 31830181		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30309709		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31284267		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1384657, 23826080, 27916606, 29048614, 30465280		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21372829		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29200724, 31060423		★☆☆☆☆ Found in Text Mining only
Pituitary dwarfism	Pituitary dwarfism	BEFREE	23436191		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26625974		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17418805, 21557276		★☆☆☆☆ Found in Text Mining only
SPLIT-HAND/FOOT MALFORMATION 3	Split-Hand-Foot Malformation	BEFREE	24038848		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25801334		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for FBXO8.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FBXO8.