FBXO39 (F-box protein 39)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 162517
• Gene name: F-box protein 39
• Gene symbol: FBXO39
• Synonyms (NCBI Gene): CT144, FBOX39, Fbx39
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box pr

miRNA Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT992288	hsa-miR-106a	CLIP-seq
MIRT992289	hsa-miR-106b	CLIP-seq
MIRT992290	hsa-miR-17	CLIP-seq
MIRT992291	hsa-miR-20a	CLIP-seq
MIRT992292	hsa-miR-20b	CLIP-seq
MIRT992293	hsa-miR-302a	CLIP-seq
MIRT992294	hsa-miR-302b	CLIP-seq
MIRT992295	hsa-miR-302c	CLIP-seq
MIRT992296	hsa-miR-302d	CLIP-seq
MIRT992297	hsa-miR-302e	CLIP-seq
MIRT992298	hsa-miR-3160-5p	CLIP-seq
MIRT992299	hsa-miR-372	CLIP-seq
MIRT992300	hsa-miR-373	CLIP-seq
MIRT992301	hsa-miR-3973	CLIP-seq
MIRT992302	hsa-miR-519d	CLIP-seq
MIRT992303	hsa-miR-520a-3p	CLIP-seq
MIRT992304	hsa-miR-520b	CLIP-seq
MIRT992305	hsa-miR-520c-3p	CLIP-seq
MIRT992306	hsa-miR-520d-3p	CLIP-seq
MIRT992307	hsa-miR-520e	CLIP-seq
MIRT992308	hsa-miR-520g	CLIP-seq
MIRT992309	hsa-miR-520h	CLIP-seq
MIRT992310	hsa-miR-93	CLIP-seq
MIRT2228325	hsa-miR-3160-3p	CLIP-seq
MIRT2228326	hsa-miR-3613-3p	CLIP-seq
MIRT2228327	hsa-miR-4633-3p	CLIP-seq
MIRT2228328	hsa-miR-490-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA

Other IDs

• MIM: 609106
• HGNC: 28565
• e!Ensembl: ENSG00000177294

Protein

• UniProt ID: Q8N4B4
• Protein name: F-box only protein 39
• Protein function: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12937	F-box-like	16 → 62	F-box-like	Domain

• Sequence:

  MDEESELIQPQDQSCWAFLPDLCLCRVFWWLGDRDRSRAALVCRKWNQMMYSAELWRYRT
  ITFSGRPSRVHASEVESAVWYVKKFGRYLEHLEVKFMNPYNAVLTKKFQVTMRGLLSCLS
  KSNNRLKSLSIQYLELDRLVWRNSIRSSFISSLSFFLKKMGKRLDYLNLKGARLTVEQGC
  QILDSLSYMRNENVISELNIEDYFSHHLAVYNSPQFKKTMSTFHNLVSLNLNYNCISDEL
  LENLCENASTLRTINIKCHVHDPHGQVIWGMSWAKLARQATNLKVNFFFERIMKYERLAR
  ILLQEIPIRSISLRSCYFSDPDCSMRPTLIDLLPTFRHTLQKLTCEFNNNHESLDEELHL
  LIISCRKLFYFKIWAFLDVSFVERILKSQKERQCALRVFKARIYTNRYETNEEDKTLQEI
  YRKYRKLIESELSYFVIVYSVM

• Sequence length: 442

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	24377578		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24377578	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	24377578	Stimulate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21338577		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27635108, 29802700, 34380828	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	40504854	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40504854	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24377578		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24377578		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24377578		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21338577		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27635108		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30008875		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for FBXO39.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FBXO39.