Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	26261
Gene name	F-box protein 24
Gene symbol	FBXO24
Synonyms (NCBI Gene)	FBX24
Chromosome	7
Chromosome location	7q22.1
Summary	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box

miRTarBase ID	miRNA	Experiments	Reference
MIRT028996	hsa-miR-26b-5p	Microarray	19088304

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	NAS	10531035
GO:0000398	Process	MRNA splicing, via spliceosome	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	NAS	10531035
GO:0005515	Function	Protein binding	IPI	22939624, 25036637, 32828318, 33961781
GO:0006325	Process	Chromatin organization	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0016567	Process	Protein ubiquitination	NAS	10531035
GO:0019005	Component	SCF ubiquitin ligase complex	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0034587	Process	PiRNA processing	IEA
GO:0035082	Process	Axoneme assembly	IEA
GO:0044782	Process	Cilium organization	IEA

MIM	HGNC	e!Ensembl
609097	13595	ENSG00000106336

O75426

Protein name

F-box only protein 24

Protein function

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00415	RCC1	376 → 422	Regulator of chromosome condensation (RCC1) repeat	Repeat
PF00646	F-box	37 → 84	F-box domain	Domain

Sequence

MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLV
ALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLYFQAFGGR
RRCLSKSVAPLLAHGYRRFLPTKDHVFILDYVGTLFFLKNALVSTLGQMQWKRACRYVVL
CRGAKDFASDPRCDTVYRKYLYVLATREPQEVVGTTSSRACDCVEVYLQSSGQRVFKMTF
HHSMTFKQIVLVGQETQRALLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPH
LRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLFGTLQAFDPLDQQMPLALSLPAKIL
FCALGYNHLGLVDEFGRIFMQGNNRYGQLGTGDKMDRGEPTQVCYLQRPITLWCGLNHSL
VLSQSSEFSKELLGCGCGAGGRLPGWPKGSASFVKLQVKVPLCACALCATRECLYILSSH
DIEQHAPYRHLPASRVVGTPEPSLGARAPQDPGGMAQACEEYLSQIHSCQTLQDRTEKMK
EIVGWMPLMAAQKDFFWEALDMLQRAEGGGGGVGPPAPET

Sequence length

580

Interactions

View interactions

Related Genes Genes most often co-reported with FBXO24 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for FBXO24.

Diseases Linked via Similar Genes Diseases curated for genes most similar to FBXO24 (see Related Genes above), that are NOT already directly curated for FBXO24 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to FBXO24.

FBXO24 (F-box protein 24)

Bookmark This Gene