Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	157574
Gene name	F-box protein 16
Gene symbol	FBXO16
Synonyms (NCBI Gene)	FBX16
Chromosome	8
Chromosome location	8p21.1
Summary	This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cul

11 Show/Hide all (11)

miRTarBase ID	miRNA	Experiments
MIRT991292	hsa-miR-1266	CLIP-seq
MIRT991293	hsa-miR-143	CLIP-seq
MIRT991294	hsa-miR-4518	CLIP-seq
MIRT991295	hsa-miR-4716-3p	CLIP-seq
MIRT991296	hsa-miR-4723-5p	CLIP-seq
MIRT991297	hsa-miR-4755-3p	CLIP-seq
MIRT991298	hsa-miR-4770	CLIP-seq
MIRT991299	hsa-miR-510	CLIP-seq
MIRT991300	hsa-miR-556-5p	CLIP-seq
MIRT1993993	hsa-miR-19a	CLIP-seq
MIRT1993994	hsa-miR-19b	CLIP-seq

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183

MIM	HGNC	e!Ensembl
608519	13618	ENSG00000214050

Q8IX29

Protein name

F-box only protein 16

Protein function

Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12937	F-box-like	89 → 135	F-box-like	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, spleen and colon. {ECO:0000269|PubMed:12243353}.

Sequence

MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTG
LLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWK
NLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIAD
VQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDP
METVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP

Sequence length

292

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (6)
Breast Neoplasms	Breast neoplasm	Pubtator	30714168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30530053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30530053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36656640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30714168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30530053, 30714168		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with FBXO16 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for FBXO16.

Diseases Linked via Similar Genes Diseases curated for genes most similar to FBXO16 (see Related Genes above), that are NOT already directly curated for FBXO16 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to FBXO16.

FBXO16 (F-box protein 16)

Bookmark This Gene