FBXL14 (F-box and leucine rich repeat protein 14)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 144699
• Gene name: F-box and leucine rich repeat protein 14
• Gene symbol: FBXL14
• Synonyms (NCBI Gene): Fbl14
• Chromosome: 12
• Chromosome location: 12p13.33
• Summary: Members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box pr

miRNA Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040331	hsa-miR-615-3p	CLASH	23622248
MIRT990245	hsa-miR-3125	CLIP-seq
MIRT990246	hsa-miR-3150a-3p	CLIP-seq
MIRT990247	hsa-miR-3175	CLIP-seq
MIRT990248	hsa-miR-3190	CLIP-seq
MIRT990249	hsa-miR-3916	CLIP-seq
MIRT990250	hsa-miR-491-5p	CLIP-seq
MIRT990251	hsa-miR-939	CLIP-seq
MIRT1993520	hsa-miR-203	CLIP-seq
MIRT1993521	hsa-miR-3127-5p	CLIP-seq
MIRT1993522	hsa-miR-3163	CLIP-seq
MIRT1993523	hsa-miR-3918	CLIP-seq
MIRT1993524	hsa-miR-3924	CLIP-seq
MIRT1993525	hsa-miR-4282	CLIP-seq
MIRT1993526	hsa-miR-4436b-3p	CLIP-seq
MIRT1993527	hsa-miR-568	CLIP-seq
MIRT1993528	hsa-miR-873	CLIP-seq
MIRT2227346	hsa-miR-198	CLIP-seq
MIRT1993521	hsa-miR-3127-5p	CLIP-seq
MIRT2227347	hsa-miR-34c-3p	CLIP-seq
MIRT2227348	hsa-miR-380	CLIP-seq
MIRT1993523	hsa-miR-3918	CLIP-seq
MIRT1993524	hsa-miR-3924	CLIP-seq
MIRT2227349	hsa-miR-4267	CLIP-seq
MIRT1993526	hsa-miR-4436b-3p	CLIP-seq
MIRT2227350	hsa-miR-4495	CLIP-seq
MIRT2227351	hsa-miR-4797-3p	CLIP-seq
MIRT1993528	hsa-miR-873	CLIP-seq

Gene ontology (GO) Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	19955572
GO:0005515	Function	Protein binding	IPI	19955572, 25203322, 27705803, 28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IDA	19955572
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	19955572
GO:0019005	Component	SCF ubiquitin ligase complex	IBA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA

Other IDs

• MIM: 609081
• HGNC: 28624
• e!Ensembl: ENSG00000171823

Protein

• UniProt ID: Q8N1E6
• Protein name: F-box/LRR-repeat protein 14 (F-box and leucine-rich repeat protein 14)
• Protein function: Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin-protein ligase complexes. The SCF(FBXL14) complex acts by mediating ubiquitination and subsequent degradation of SNAI1.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12937	F-box-like	6 → 49	F-box-like	Domain
  PF13516	LRR_6	254 → 275	Leucine Rich repeat	Repeat
  PF13516	LRR_6	167 → 191	Leucine Rich repeat	Repeat
  PF13516	LRR_6	226 → 250	Leucine Rich repeat	Repeat
  PF13516	LRR_6	328 → 352	Leucine Rich repeat	Repeat
  PF13516	LRR_6	118 → 139	Leucine Rich repeat	Repeat

• Sequence:

  METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPS
  LFPSLQARGIRRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLR
  ALNLSLCKQITDSSLGRIAQYLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCR
  HLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLSFCGG
  ISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYI
  AQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTG
  IDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSSRR

• Sequence length: 418

Pathways

Reactome Pathway

Neddylation

Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (6)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cholangiocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	29973690		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27923907	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29973690		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29601127		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27923907		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	21144913		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29601127		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for FBXL14.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FBXL14.