FBLL1 (fibrillarin like 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 345630
• Gene name: Fibrillarin like 1
• Gene symbol: FBLL1
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q34

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000494	Process	Box C/D sno(s)RNA 3'-end processing	IBA
GO:0001650	Component	Fibrillar center	IDA
GO:0001650	Component	Fibrillar center	IEA
GO:0001835	Process	Blastocyst hatching	IEA
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	39570315
GO:0005730	Component	Nucleolus	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006364	Process	RRNA processing	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008649	Function	RRNA methyltransferase activity	IBA
GO:0015030	Component	Cajal body	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0031167	Process	RRNA methylation	IBA
GO:0031428	Component	Box C/D methylation guide snoRNP complex	IBA
GO:0031428	Component	Box C/D methylation guide snoRNP complex	IDA	39570315
GO:0031428	Component	Box C/D methylation guide snoRNP complex	IEA
GO:0032040	Component	Small-subunit processome	IBA
GO:0032259	Process	Methylation	IEA
GO:0048255	Process	MRNA stabilization	IEA
GO:0048255	Process	MRNA stabilization	ISS
GO:0062105	Function	RNA 2'-O-methyltransferase activity	IDA	39570315
GO:0062105	Function	RNA 2'-O-methyltransferase activity	IEA
GO:1990259	Function	Histone H2AQ104 methyltransferase activity	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A6NHQ2
• Protein name: RNA 2'-O-methyltransferase FBLL1 (EC 2.1.1.-) (Fibrillarin like 1)
• Protein function: S-adenosyl-L-methionine-dependent RNA methyltransferase that catalyzes 2'-hydroxyl ribose methylation in RNAs (PubMed:39570315). Functions as part of box C/D small nucleolar ribonucleoprotein (snoRNP) complexes, where guide snoRNAs ensure methyl
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01269	Fibrillarin	100 → 327	Fibrillarin	Domain

• Sequence:

  MKSAASSRGGGGGGRGGGGWGSWGGGRGGGGGAGKGGGGDGGGQGGKGGFGARARGFGGG
  GRGRGRGGGDGKDRGGGGQRRGGVAKSKSRRRKGAMVVSVEPHRHEGVFIYRGAEDALVT
  LNMVPGQSVYGERRVTVTEGGVKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGA
  ASGTTVSHVSDIIGPDGLVYAVEFSHRAGRDLVNVAKKRTNIIPVLEDARHPLKYRMLIG
  MVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANCIDSTASAEAVFASEVRKLQQ
  ENLKPQEQLTLEPYERDHAVVVGVYRPLPKSSSK

• Sequence length: 334

Pathways

KEGG Pathway:

Ribosome biogenesis in eukaryotes

Related Genes

No strongly related genes found yet for FBLL1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FBLL1.