FASTKD3 (FAST kinase domains 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79072
• Gene name: FAST kinase domains 3
• Gene symbol: FASTKD3
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5p15.31
• Summary: This gene encodes a member of a small family of Fas-activated serine/threonine kinase domain (FASTKD) containing proteins that share an amino terminal mitochondrial targeting domain and multiple carboxy terminal FAST domains as well as a putative RNA-bind

miRNA Show/Hide all (61)

miRTarBase ID	miRNA	Experiments	Reference
MIRT989742	hsa-miR-2276	CLIP-seq
MIRT989743	hsa-miR-23a	CLIP-seq
MIRT989744	hsa-miR-23b	CLIP-seq
MIRT989745	hsa-miR-23c	CLIP-seq
MIRT989746	hsa-miR-3120-3p	CLIP-seq
MIRT989747	hsa-miR-4452	CLIP-seq
MIRT989748	hsa-miR-4528	CLIP-seq
MIRT989749	hsa-miR-4760-3p	CLIP-seq
MIRT989750	hsa-miR-4772-3p	CLIP-seq
MIRT989751	hsa-miR-4773	CLIP-seq
MIRT989752	hsa-miR-4778-5p	CLIP-seq
MIRT989753	hsa-miR-4796-3p	CLIP-seq
MIRT989754	hsa-miR-518a-5p	CLIP-seq
MIRT989755	hsa-miR-520g	CLIP-seq
MIRT989756	hsa-miR-520h	CLIP-seq
MIRT989757	hsa-miR-527	CLIP-seq
MIRT989758	hsa-miR-544	CLIP-seq
MIRT989747	hsa-miR-4452	CLIP-seq
MIRT1548585	hsa-miR-4729	CLIP-seq
MIRT1548586	hsa-miR-664	CLIP-seq
MIRT1993329	hsa-miR-200b	CLIP-seq
MIRT1993330	hsa-miR-200c	CLIP-seq
MIRT989746	hsa-miR-3120-3p	CLIP-seq
MIRT1993331	hsa-miR-374c	CLIP-seq
MIRT1993332	hsa-miR-429	CLIP-seq
MIRT989747	hsa-miR-4452	CLIP-seq
MIRT1993333	hsa-miR-4682	CLIP-seq
MIRT1548585	hsa-miR-4729	CLIP-seq
MIRT989751	hsa-miR-4773	CLIP-seq
MIRT1993334	hsa-miR-655	CLIP-seq
MIRT1548586	hsa-miR-664	CLIP-seq
MIRT2227170	hsa-miR-1226	CLIP-seq
MIRT1993329	hsa-miR-200b	CLIP-seq
MIRT1993330	hsa-miR-200c	CLIP-seq
MIRT989742	hsa-miR-2276	CLIP-seq
MIRT989743	hsa-miR-23a	CLIP-seq
MIRT989744	hsa-miR-23b	CLIP-seq
MIRT989745	hsa-miR-23c	CLIP-seq
MIRT2227171	hsa-miR-3160-5p	CLIP-seq
MIRT1993331	hsa-miR-374c	CLIP-seq
MIRT2227172	hsa-miR-3942-3p	CLIP-seq
MIRT1993332	hsa-miR-429	CLIP-seq
MIRT989748	hsa-miR-4528	CLIP-seq
MIRT1993333	hsa-miR-4682	CLIP-seq
MIRT2227173	hsa-miR-4733-3p	CLIP-seq
MIRT989749	hsa-miR-4760-3p	CLIP-seq
MIRT989750	hsa-miR-4772-3p	CLIP-seq
MIRT989751	hsa-miR-4773	CLIP-seq
MIRT989752	hsa-miR-4778-5p	CLIP-seq
MIRT989753	hsa-miR-4796-3p	CLIP-seq
MIRT989754	hsa-miR-518a-5p	CLIP-seq
MIRT989755	hsa-miR-520g	CLIP-seq
MIRT989756	hsa-miR-520h	CLIP-seq
MIRT989757	hsa-miR-527	CLIP-seq
MIRT989758	hsa-miR-544	CLIP-seq
MIRT2227174	hsa-miR-587	CLIP-seq
MIRT1993334	hsa-miR-655	CLIP-seq
MIRT2531129	hsa-miR-3117-5p	CLIP-seq
MIRT2531130	hsa-miR-3923	CLIP-seq
MIRT2531131	hsa-miR-4282	CLIP-seq
MIRT2531132	hsa-miR-4704-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000963	Process	Mitochondrial RNA processing	IBA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	20869947, 27789713
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0033617	Process	Mitochondrial cytochrome c oxidase assembly	IDA	27789713
GO:0035770	Component	Ribonucleoprotein granule	IBA
GO:0044528	Process	Regulation of mitochondrial mRNA stability	IBA
GO:0044528	Process	Regulation of mitochondrial mRNA stability	IDA	27789713
GO:0044528	Process	Regulation of mitochondrial mRNA stability	IEA
GO:0070131	Process	Positive regulation of mitochondrial translation	IDA	27789713

Other IDs

• MIM: 617530
• HGNC: 28758
• e!Ensembl: ENSG00000124279

Protein

• UniProt ID: Q14CZ7
• Protein name: FAST kinase domain-containing protein 3, mitochondrial
• Protein function: Required for normal mitochondrial respiration (PubMed:20869947). Increases steady-state levels and half-lives of a subset of mature mitochondrial mRNAs MT-ND2, MT-ND3, MT-CYTB, MT-CO2, and MT-ATP8/6. Promotes MT-CO1 mRNA translation and increase
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06743	FAST_1	409 → 477	FAST kinase-like protein, subdomain 1	Family
  PF08368	FAST_2	490 → 580	FAST kinase-like protein, subdomain 2	Family
  PF08373	RAP	593 → 650	RAP domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expression detected in spleen, thymus, testis, ovary, colon, heart, smooth muscle, kidney, brain, lung, liver and white adipose tissue with highest expression in liver and thyroid. {ECO:0000269|PubMed:20869947}.
• Sequence:

  MALITLRKNLYRLSDFQMHRALAALKNKPLNHVHKVVKERLCPWLCSRQPEPFGVKFHHA
  HCKKFHSKNGNDLHPLGGPVFSQVSDCDRLEQNVKNEESQMFYRRLSNLTSSEEVLSFIS
  TMETLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEPSQLSNTSLVT
  ALQALILLHVDPQSSLLLNLVAECQNRLRKGGMEVRNLCILGESLITLHSSGCVTLELII
  NQLQGEKLETFTPEDIVALYRILQACTEKVDEHQTFLNKINNFSLSIVSNLSPKLISQML
  TALVVLDQSQAFPLIIKLGKYVVRHVPHFTNEELRRVLEAFIYFGHHDTFFTKALEHRVA
  AVCLTLDPEVVCRVMEYCSRELILSKPILNAVAETFVCQTEKFSPRQISALMEPFGKLNY
  LPPNASALFRKLENVLFTHFNYFPPKSLLKLLHSCSLNECHPVNFLAKIFKPLFLQRLQG
  KESHLDTLSRAQLTQLFLASVLECPFYKGPKLLPKYQVKSFLTPCCSLETPVDSQLYRYV
  KIGLTNLLGARLYFAPKVLTPYCYTIDVEIKLDEEGFVLPSTANEDIHKRIALCIDGPKR
  FCSNSKHLLGKEAIKQRHLQLLGYQVVQIPYHEIGMLKSRRELVEYLQRKLFSQNTVHWL
  QE

• Sequence length: 662

Related Genes

No strongly related genes found yet for FASTKD3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to FASTKD3.