FASN (fatty acid synthase)

Gene

• Entrez ID: 2194
• Gene name: Fatty acid synthase
• Gene symbol: FASN
• Synonyms (NCBI Gene): FAS, OA-519, SDR27X1
• Chromosome: 17
• Chromosome location: 17q25.3
• Summary: The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this pro

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs145515446	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051341	hsa-miR-15a-5p	CLASH	23622248
MIRT050921	hsa-miR-17-5p	CLASH	23622248
MIRT050182	hsa-miR-26a-5p	CLASH	23622248
MIRT049363	hsa-miR-92a-3p	CLASH	23622248
MIRT048815	hsa-miR-93-5p	CLASH	23622248
MIRT048070	hsa-miR-197-3p	CLASH	23622248
MIRT047715	hsa-miR-10a-5p	CLASH	23622248
MIRT047454	hsa-miR-10b-5p	CLASH	23622248
MIRT046667	hsa-miR-222-3p	CLASH	23622248
MIRT046177	hsa-miR-27b-3p	CLASH	23622248
MIRT046177	hsa-miR-27b-3p	CLASH	23622248
MIRT044920	hsa-miR-186-5p	CLASH	23622248
MIRT044920	hsa-miR-186-5p	CLASH	23622248
MIRT043627	hsa-miR-326	CLASH	23622248
MIRT043627	hsa-miR-326	CLASH	23622248
MIRT043370	hsa-miR-331-3p	CLASH	23622248
MIRT042890	hsa-miR-324-3p	CLASH	23622248
MIRT042639	hsa-miR-423-3p	CLASH	23622248
MIRT041844	hsa-miR-484	CLASH	23622248
MIRT041844	hsa-miR-484	CLASH	23622248
MIRT041844	hsa-miR-484	CLASH	23622248
MIRT041844	hsa-miR-484	CLASH	23622248
MIRT041844	hsa-miR-484	CLASH	23622248
MIRT041353	hsa-miR-193b-3p	CLASH	23622248
MIRT041353	hsa-miR-193b-3p	CLASH	23622248
MIRT040657	hsa-miR-92b-3p	CLASH	23622248
MIRT039824	hsa-miR-615-3p	CLASH	23622248
MIRT039824	hsa-miR-615-3p	CLASH	23622248
MIRT039824	hsa-miR-615-3p	CLASH	23622248
MIRT039824	hsa-miR-615-3p	CLASH	23622248
MIRT038318	hsa-miR-130b-5p	CLASH	23622248
MIRT037647	hsa-miR-744-5p	CLASH	23622248
MIRT037647	hsa-miR-744-5p	CLASH	23622248
MIRT036832	hsa-miR-877-3p	CLASH	23622248
MIRT036557	hsa-miR-942-5p	CLASH	23622248
MIRT035891	hsa-miR-1303	CLASH	23622248
MIRT035847	hsa-miR-1268a	CLASH	23622248
MIRT035759	hsa-miR-2110	CLASH	23622248
MIRT053106	hsa-miR-424-5p	Luciferase reporter assay, Western blot	23599729
MIRT053228	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	23162665
MIRT054707	hsa-miR-1-3p	qRT-PCR, Western blot	24310399
MIRT658284	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT658283	hsa-miR-1264	HITS-CLIP	23824327
MIRT658282	hsa-miR-6861-5p	HITS-CLIP	23824327
MIRT658281	hsa-miR-6776-5p	HITS-CLIP	23824327
MIRT658280	hsa-miR-3182	HITS-CLIP	23824327
MIRT658279	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT658278	hsa-miR-4314	HITS-CLIP	23824327
MIRT658277	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT548285	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT548284	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT548283	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT548282	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT053106	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT051341	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT053228	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT548281	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT548280	hsa-miR-15b-3p	PAR-CLIP	20371350
MIRT548285	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT548284	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT548283	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT548282	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT053106	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT051341	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT053228	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT548281	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT548280	hsa-miR-15b-3p	PAR-CLIP	20371350
MIRT548285	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT548284	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT548283	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT548282	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT053106	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT051341	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT053228	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT548281	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT548280	hsa-miR-15b-3p	PAR-CLIP	21572407
MIRT756169	hsa-miR-532-5p	qRT-PCR, Western blot	25983556
MIRT047715	hsa-miR-10a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33128541
MIRT735807	hsa-miR-27a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32975270
MIRT658284	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT658283	hsa-miR-1264	HITS-CLIP	23824327
MIRT658282	hsa-miR-6861-5p	HITS-CLIP	23824327
MIRT658281	hsa-miR-6776-5p	HITS-CLIP	23824327
MIRT658280	hsa-miR-3182	HITS-CLIP	23824327
MIRT658279	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT658278	hsa-miR-4314	HITS-CLIP	23824327
MIRT658277	hsa-miR-4774-3p	HITS-CLIP	23824327
MIRT548285	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT548284	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT548283	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT548282	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT053106	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT051341	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT053228	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT548281	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT548280	hsa-miR-15b-3p	PAR-CLIP	20371350
MIRT548285	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT548284	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT548283	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT548282	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT053106	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT051341	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT053228	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT548281	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT548280	hsa-miR-15b-3p	PAR-CLIP	20371350
MIRT548285	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT548284	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT548283	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT548282	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT053106	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT051341	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT053228	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT548281	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT548280	hsa-miR-15b-3p	PAR-CLIP	21572407
MIRT756169	hsa-miR-532-5p	Luciferase reporter assay, Immunoprecipitaion (IP)	35499057
MIRT548285	hsa-miR-497-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34789312
MIRT548285	hsa-miR-497-5p	Luciferase reporter assay, Western blotting, qRT-PCR	34789312
MIRT989500	hsa-miR-101	CLIP-seq
MIRT989501	hsa-miR-103a	CLIP-seq
MIRT989502	hsa-miR-107	CLIP-seq
MIRT989503	hsa-miR-1207-5p	CLIP-seq
MIRT989504	hsa-miR-1224-3p	CLIP-seq
MIRT989505	hsa-miR-1260	CLIP-seq
MIRT989506	hsa-miR-1260b	CLIP-seq
MIRT989507	hsa-miR-1270	CLIP-seq
MIRT989508	hsa-miR-1280	CLIP-seq
MIRT989509	hsa-miR-1286	CLIP-seq
MIRT989510	hsa-miR-1293	CLIP-seq
MIRT989511	hsa-miR-1302	CLIP-seq
MIRT989512	hsa-miR-144	CLIP-seq
MIRT989513	hsa-miR-147b	CLIP-seq
MIRT989514	hsa-miR-1539	CLIP-seq
MIRT989515	hsa-miR-15a	CLIP-seq
MIRT989516	hsa-miR-15b	CLIP-seq
MIRT989517	hsa-miR-16	CLIP-seq
MIRT989518	hsa-miR-195	CLIP-seq
MIRT989519	hsa-miR-198	CLIP-seq
MIRT989520	hsa-miR-2278	CLIP-seq
MIRT989521	hsa-miR-3065-3p	CLIP-seq
MIRT989522	hsa-miR-3074-5p	CLIP-seq
MIRT989523	hsa-miR-3136-3p	CLIP-seq
MIRT989524	hsa-miR-3138	CLIP-seq
MIRT989525	hsa-miR-3150b-3p	CLIP-seq
MIRT989526	hsa-miR-3177-5p	CLIP-seq
MIRT989527	hsa-miR-3193	CLIP-seq
MIRT989528	hsa-miR-3195	CLIP-seq
MIRT989529	hsa-miR-34a	CLIP-seq
MIRT989530	hsa-miR-34c-5p	CLIP-seq
MIRT989531	hsa-miR-3591-3p	CLIP-seq
MIRT989532	hsa-miR-3656	CLIP-seq
MIRT989533	hsa-miR-3657	CLIP-seq
MIRT989534	hsa-miR-3660	CLIP-seq
MIRT989535	hsa-miR-3687	CLIP-seq
MIRT989536	hsa-miR-3689a-3p	CLIP-seq
MIRT989537	hsa-miR-3689c	CLIP-seq
MIRT989538	hsa-miR-3908	CLIP-seq
MIRT989539	hsa-miR-3929	CLIP-seq
MIRT989540	hsa-miR-3945	CLIP-seq
MIRT989541	hsa-miR-3960	CLIP-seq
MIRT989542	hsa-miR-424	CLIP-seq
MIRT989543	hsa-miR-4265	CLIP-seq
MIRT989544	hsa-miR-4286	CLIP-seq
MIRT989545	hsa-miR-4294	CLIP-seq
MIRT989546	hsa-miR-4296	CLIP-seq
MIRT989547	hsa-miR-4298	CLIP-seq
MIRT989548	hsa-miR-4299	CLIP-seq
MIRT989549	hsa-miR-4310	CLIP-seq
MIRT989550	hsa-miR-4322	CLIP-seq
MIRT989551	hsa-miR-4419b	CLIP-seq
MIRT989552	hsa-miR-4436b-3p	CLIP-seq
MIRT989553	hsa-miR-4442	CLIP-seq
MIRT989554	hsa-miR-4455	CLIP-seq
MIRT989555	hsa-miR-4456	CLIP-seq
MIRT989556	hsa-miR-4467	CLIP-seq
MIRT989557	hsa-miR-4478	CLIP-seq
MIRT989558	hsa-miR-4483	CLIP-seq
MIRT989559	hsa-miR-4488	CLIP-seq
MIRT989560	hsa-miR-449a	CLIP-seq
MIRT989561	hsa-miR-449b	CLIP-seq
MIRT989562	hsa-miR-4520a-3p	CLIP-seq
MIRT989563	hsa-miR-4524	CLIP-seq
MIRT989564	hsa-miR-4526	CLIP-seq
MIRT989565	hsa-miR-4635	CLIP-seq
MIRT989566	hsa-miR-4645-3p	CLIP-seq
MIRT989567	hsa-miR-4648	CLIP-seq
MIRT989568	hsa-miR-4650-5p	CLIP-seq
MIRT989569	hsa-miR-4653-3p	CLIP-seq
MIRT989570	hsa-miR-4654	CLIP-seq
MIRT989571	hsa-miR-4660	CLIP-seq
MIRT989572	hsa-miR-4683	CLIP-seq
MIRT989573	hsa-miR-4684-5p	CLIP-seq
MIRT989574	hsa-miR-4687-3p	CLIP-seq
MIRT989575	hsa-miR-4689	CLIP-seq
MIRT989576	hsa-miR-4690-3p	CLIP-seq
MIRT989577	hsa-miR-4697-5p	CLIP-seq
MIRT989578	hsa-miR-4698	CLIP-seq
MIRT989579	hsa-miR-4706	CLIP-seq
MIRT989580	hsa-miR-4717-3p	CLIP-seq
MIRT989581	hsa-miR-4728-5p	CLIP-seq
MIRT989582	hsa-miR-4734	CLIP-seq
MIRT989583	hsa-miR-4736	CLIP-seq
MIRT989584	hsa-miR-4743	CLIP-seq
MIRT989585	hsa-miR-4749-5p	CLIP-seq
MIRT989586	hsa-miR-4763-3p	CLIP-seq
MIRT989587	hsa-miR-4767	CLIP-seq
MIRT989588	hsa-miR-4769-5p	CLIP-seq
MIRT989589	hsa-miR-4784	CLIP-seq
MIRT989590	hsa-miR-4787-5p	CLIP-seq
MIRT989591	hsa-miR-4802-3p	CLIP-seq
MIRT989592	hsa-miR-485-5p	CLIP-seq
MIRT989593	hsa-miR-495	CLIP-seq
MIRT989594	hsa-miR-497	CLIP-seq
MIRT989595	hsa-miR-503	CLIP-seq
MIRT989596	hsa-miR-512-5p	CLIP-seq
MIRT989597	hsa-miR-513a-3p	CLIP-seq
MIRT989598	hsa-miR-526b	CLIP-seq
MIRT989599	hsa-miR-544b	CLIP-seq
MIRT989600	hsa-miR-548q	CLIP-seq
MIRT989601	hsa-miR-564	CLIP-seq
MIRT989602	hsa-miR-571	CLIP-seq
MIRT989603	hsa-miR-578	CLIP-seq
MIRT989604	hsa-miR-582-5p	CLIP-seq
MIRT989605	hsa-miR-607	CLIP-seq
MIRT989606	hsa-miR-609	CLIP-seq
MIRT989607	hsa-miR-615-5p	CLIP-seq
MIRT989608	hsa-miR-620	CLIP-seq
MIRT989609	hsa-miR-634	CLIP-seq
MIRT989610	hsa-miR-637	CLIP-seq
MIRT989611	hsa-miR-646	CLIP-seq
MIRT989612	hsa-miR-661	CLIP-seq
MIRT989613	hsa-miR-711	CLIP-seq
MIRT989614	hsa-miR-744	CLIP-seq
MIRT989615	hsa-miR-759	CLIP-seq
MIRT989616	hsa-miR-924	CLIP-seq
MIRT989617	hsa-miR-935	CLIP-seq
MIRT989500	hsa-miR-101	CLIP-seq
MIRT989501	hsa-miR-103a	CLIP-seq
MIRT989502	hsa-miR-107	CLIP-seq
MIRT989503	hsa-miR-1207-5p	CLIP-seq
MIRT989504	hsa-miR-1224-3p	CLIP-seq
MIRT989505	hsa-miR-1260	CLIP-seq
MIRT989506	hsa-miR-1260b	CLIP-seq
MIRT1993284	hsa-miR-1262	CLIP-seq
MIRT989507	hsa-miR-1270	CLIP-seq
MIRT989508	hsa-miR-1280	CLIP-seq
MIRT989509	hsa-miR-1286	CLIP-seq
MIRT1993285	hsa-miR-1291	CLIP-seq
MIRT989510	hsa-miR-1293	CLIP-seq
MIRT989511	hsa-miR-1302	CLIP-seq
MIRT989512	hsa-miR-144	CLIP-seq
MIRT1993286	hsa-miR-146b-3p	CLIP-seq
MIRT989515	hsa-miR-15a	CLIP-seq
MIRT989516	hsa-miR-15b	CLIP-seq
MIRT989517	hsa-miR-16	CLIP-seq
MIRT1993287	hsa-miR-1908	CLIP-seq
MIRT1993288	hsa-miR-1909	CLIP-seq
MIRT1993289	hsa-miR-1914	CLIP-seq
MIRT989518	hsa-miR-195	CLIP-seq
MIRT989519	hsa-miR-198	CLIP-seq
MIRT1993290	hsa-miR-214	CLIP-seq
MIRT989520	hsa-miR-2278	CLIP-seq
MIRT1993291	hsa-miR-27a	CLIP-seq
MIRT1993292	hsa-miR-27b	CLIP-seq
MIRT989524	hsa-miR-3138	CLIP-seq
MIRT989525	hsa-miR-3150b-3p	CLIP-seq
MIRT989526	hsa-miR-3177-5p	CLIP-seq
MIRT1993293	hsa-miR-342-5p	CLIP-seq
MIRT989529	hsa-miR-34a	CLIP-seq
MIRT989530	hsa-miR-34c-5p	CLIP-seq
MIRT989531	hsa-miR-3591-3p	CLIP-seq
MIRT1993294	hsa-miR-3619-5p	CLIP-seq
MIRT1993295	hsa-miR-3646	CLIP-seq
MIRT989532	hsa-miR-3656	CLIP-seq
MIRT989533	hsa-miR-3657	CLIP-seq
MIRT989534	hsa-miR-3660	CLIP-seq
MIRT1993296	hsa-miR-3662	CLIP-seq
MIRT989535	hsa-miR-3687	CLIP-seq
MIRT989536	hsa-miR-3689a-3p	CLIP-seq
MIRT989537	hsa-miR-3689c	CLIP-seq
MIRT1993297	hsa-miR-3691-3p	CLIP-seq
MIRT989538	hsa-miR-3908	CLIP-seq
MIRT989539	hsa-miR-3929	CLIP-seq
MIRT1993298	hsa-miR-3944-5p	CLIP-seq
MIRT989541	hsa-miR-3960	CLIP-seq
MIRT1993299	hsa-miR-412	CLIP-seq
MIRT989542	hsa-miR-424	CLIP-seq
MIRT989543	hsa-miR-4265	CLIP-seq
MIRT989545	hsa-miR-4294	CLIP-seq
MIRT989546	hsa-miR-4296	CLIP-seq
MIRT989547	hsa-miR-4298	CLIP-seq
MIRT989548	hsa-miR-4299	CLIP-seq
MIRT989549	hsa-miR-4310	CLIP-seq
MIRT989550	hsa-miR-4322	CLIP-seq
MIRT989551	hsa-miR-4419b	CLIP-seq
MIRT1993300	hsa-miR-4433	CLIP-seq
MIRT989553	hsa-miR-4442	CLIP-seq
MIRT989554	hsa-miR-4455	CLIP-seq
MIRT989555	hsa-miR-4456	CLIP-seq
MIRT989556	hsa-miR-4467	CLIP-seq
MIRT989557	hsa-miR-4478	CLIP-seq
MIRT989558	hsa-miR-4483	CLIP-seq
MIRT989559	hsa-miR-4488	CLIP-seq
MIRT989560	hsa-miR-449a	CLIP-seq
MIRT989561	hsa-miR-449b	CLIP-seq
MIRT989562	hsa-miR-4520a-3p	CLIP-seq
MIRT989563	hsa-miR-4524	CLIP-seq
MIRT989564	hsa-miR-4526	CLIP-seq
MIRT1993301	hsa-miR-4530	CLIP-seq
MIRT989565	hsa-miR-4635	CLIP-seq
MIRT989566	hsa-miR-4645-3p	CLIP-seq
MIRT989567	hsa-miR-4648	CLIP-seq
MIRT989568	hsa-miR-4650-5p	CLIP-seq
MIRT1993302	hsa-miR-4651	CLIP-seq
MIRT989570	hsa-miR-4654	CLIP-seq
MIRT989571	hsa-miR-4660	CLIP-seq
MIRT1993303	hsa-miR-4664-5p	CLIP-seq
MIRT989572	hsa-miR-4683	CLIP-seq
MIRT989573	hsa-miR-4684-5p	CLIP-seq
MIRT989575	hsa-miR-4689	CLIP-seq
MIRT1993304	hsa-miR-4690-5p	CLIP-seq
MIRT989577	hsa-miR-4697-5p	CLIP-seq
MIRT989578	hsa-miR-4698	CLIP-seq
MIRT1993305	hsa-miR-4701-3p	CLIP-seq
MIRT1993306	hsa-miR-4707-3p	CLIP-seq
MIRT989580	hsa-miR-4717-3p	CLIP-seq
MIRT989581	hsa-miR-4728-5p	CLIP-seq
MIRT989583	hsa-miR-4736	CLIP-seq
MIRT989584	hsa-miR-4743	CLIP-seq
MIRT989586	hsa-miR-4763-3p	CLIP-seq
MIRT989588	hsa-miR-4769-5p	CLIP-seq
MIRT989589	hsa-miR-4784	CLIP-seq
MIRT989590	hsa-miR-4787-5p	CLIP-seq
MIRT989592	hsa-miR-485-5p	CLIP-seq
MIRT989593	hsa-miR-495	CLIP-seq
MIRT989594	hsa-miR-497	CLIP-seq
MIRT989595	hsa-miR-503	CLIP-seq
MIRT989597	hsa-miR-513a-3p	CLIP-seq
MIRT1993307	hsa-miR-513a-5p	CLIP-seq
MIRT1993308	hsa-miR-515-5p	CLIP-seq
MIRT989598	hsa-miR-526b	CLIP-seq
MIRT1993309	hsa-miR-542-5p	CLIP-seq
MIRT989599	hsa-miR-544b	CLIP-seq
MIRT1993310	hsa-miR-548c-3p	CLIP-seq
MIRT989600	hsa-miR-548q	CLIP-seq
MIRT1993311	hsa-miR-550a	CLIP-seq
MIRT989603	hsa-miR-578	CLIP-seq
MIRT989604	hsa-miR-582-5p	CLIP-seq
MIRT1993312	hsa-miR-604	CLIP-seq
MIRT989605	hsa-miR-607	CLIP-seq
MIRT1993313	hsa-miR-608	CLIP-seq
MIRT989606	hsa-miR-609	CLIP-seq
MIRT989607	hsa-miR-615-5p	CLIP-seq
MIRT989608	hsa-miR-620	CLIP-seq
MIRT989609	hsa-miR-634	CLIP-seq
MIRT989610	hsa-miR-637	CLIP-seq
MIRT1993314	hsa-miR-644	CLIP-seq
MIRT989611	hsa-miR-646	CLIP-seq
MIRT1993315	hsa-miR-647	CLIP-seq
MIRT989612	hsa-miR-661	CLIP-seq
MIRT1993316	hsa-miR-663	CLIP-seq
MIRT1993317	hsa-miR-663b	CLIP-seq
MIRT1993318	hsa-miR-665	CLIP-seq
MIRT989613	hsa-miR-711	CLIP-seq
MIRT989615	hsa-miR-759	CLIP-seq
MIRT1993319	hsa-miR-761	CLIP-seq
MIRT989616	hsa-miR-924	CLIP-seq
MIRT989617	hsa-miR-935	CLIP-seq
MIRT989500	hsa-miR-101	CLIP-seq
MIRT989501	hsa-miR-103a	CLIP-seq
MIRT989502	hsa-miR-107	CLIP-seq
MIRT989503	hsa-miR-1207-5p	CLIP-seq
MIRT989504	hsa-miR-1224-3p	CLIP-seq
MIRT989505	hsa-miR-1260	CLIP-seq
MIRT989506	hsa-miR-1260b	CLIP-seq
MIRT1993284	hsa-miR-1262	CLIP-seq
MIRT989508	hsa-miR-1280	CLIP-seq
MIRT989509	hsa-miR-1286	CLIP-seq
MIRT989510	hsa-miR-1293	CLIP-seq
MIRT989511	hsa-miR-1302	CLIP-seq
MIRT989512	hsa-miR-144	CLIP-seq
MIRT989514	hsa-miR-1539	CLIP-seq
MIRT989515	hsa-miR-15a	CLIP-seq
MIRT989516	hsa-miR-15b	CLIP-seq
MIRT989517	hsa-miR-16	CLIP-seq
MIRT1993287	hsa-miR-1908	CLIP-seq
MIRT1993288	hsa-miR-1909	CLIP-seq
MIRT1993289	hsa-miR-1914	CLIP-seq
MIRT989518	hsa-miR-195	CLIP-seq
MIRT989519	hsa-miR-198	CLIP-seq
MIRT1993290	hsa-miR-214	CLIP-seq
MIRT989520	hsa-miR-2278	CLIP-seq
MIRT1993291	hsa-miR-27a	CLIP-seq
MIRT1993292	hsa-miR-27b	CLIP-seq
MIRT989521	hsa-miR-3065-3p	CLIP-seq
MIRT989522	hsa-miR-3074-5p	CLIP-seq
MIRT989524	hsa-miR-3138	CLIP-seq
MIRT989525	hsa-miR-3150b-3p	CLIP-seq
MIRT989526	hsa-miR-3177-5p	CLIP-seq
MIRT989527	hsa-miR-3193	CLIP-seq
MIRT989528	hsa-miR-3195	CLIP-seq
MIRT1993293	hsa-miR-342-5p	CLIP-seq
MIRT989531	hsa-miR-3591-3p	CLIP-seq
MIRT1993294	hsa-miR-3619-5p	CLIP-seq
MIRT1993295	hsa-miR-3646	CLIP-seq
MIRT989532	hsa-miR-3656	CLIP-seq
MIRT989534	hsa-miR-3660	CLIP-seq
MIRT1993296	hsa-miR-3662	CLIP-seq
MIRT989535	hsa-miR-3687	CLIP-seq
MIRT989536	hsa-miR-3689a-3p	CLIP-seq
MIRT989537	hsa-miR-3689c	CLIP-seq
MIRT989538	hsa-miR-3908	CLIP-seq
MIRT989539	hsa-miR-3929	CLIP-seq
MIRT1993298	hsa-miR-3944-5p	CLIP-seq
MIRT989540	hsa-miR-3945	CLIP-seq
MIRT989541	hsa-miR-3960	CLIP-seq
MIRT1993299	hsa-miR-412	CLIP-seq
MIRT989542	hsa-miR-424	CLIP-seq
MIRT989543	hsa-miR-4265	CLIP-seq
MIRT989545	hsa-miR-4294	CLIP-seq
MIRT989546	hsa-miR-4296	CLIP-seq
MIRT989547	hsa-miR-4298	CLIP-seq
MIRT989549	hsa-miR-4310	CLIP-seq
MIRT989550	hsa-miR-4322	CLIP-seq
MIRT989551	hsa-miR-4419b	CLIP-seq
MIRT989552	hsa-miR-4436b-3p	CLIP-seq
MIRT989553	hsa-miR-4442	CLIP-seq
MIRT989556	hsa-miR-4467	CLIP-seq
MIRT989557	hsa-miR-4478	CLIP-seq
MIRT989558	hsa-miR-4483	CLIP-seq
MIRT989562	hsa-miR-4520a-3p	CLIP-seq
MIRT989564	hsa-miR-4526	CLIP-seq
MIRT1993301	hsa-miR-4530	CLIP-seq
MIRT989566	hsa-miR-4645-3p	CLIP-seq
MIRT989567	hsa-miR-4648	CLIP-seq
MIRT989568	hsa-miR-4650-5p	CLIP-seq
MIRT1993302	hsa-miR-4651	CLIP-seq
MIRT989569	hsa-miR-4653-3p	CLIP-seq
MIRT989570	hsa-miR-4654	CLIP-seq
MIRT1993303	hsa-miR-4664-5p	CLIP-seq
MIRT989573	hsa-miR-4684-5p	CLIP-seq
MIRT989575	hsa-miR-4689	CLIP-seq
MIRT989576	hsa-miR-4690-3p	CLIP-seq
MIRT1993304	hsa-miR-4690-5p	CLIP-seq
MIRT989578	hsa-miR-4698	CLIP-seq
MIRT1993305	hsa-miR-4701-3p	CLIP-seq
MIRT1993306	hsa-miR-4707-3p	CLIP-seq
MIRT989581	hsa-miR-4728-5p	CLIP-seq
MIRT989582	hsa-miR-4734	CLIP-seq
MIRT989583	hsa-miR-4736	CLIP-seq
MIRT989584	hsa-miR-4743	CLIP-seq
MIRT989586	hsa-miR-4763-3p	CLIP-seq
MIRT989587	hsa-miR-4767	CLIP-seq
MIRT989588	hsa-miR-4769-5p	CLIP-seq
MIRT989589	hsa-miR-4784	CLIP-seq
MIRT989590	hsa-miR-4787-5p	CLIP-seq
MIRT989591	hsa-miR-4802-3p	CLIP-seq
MIRT989592	hsa-miR-485-5p	CLIP-seq
MIRT989594	hsa-miR-497	CLIP-seq
MIRT989597	hsa-miR-513a-3p	CLIP-seq
MIRT1993307	hsa-miR-513a-5p	CLIP-seq
MIRT1993309	hsa-miR-542-5p	CLIP-seq
MIRT989599	hsa-miR-544b	CLIP-seq
MIRT1993310	hsa-miR-548c-3p	CLIP-seq
MIRT1993311	hsa-miR-550a	CLIP-seq
MIRT989601	hsa-miR-564	CLIP-seq
MIRT989602	hsa-miR-571	CLIP-seq
MIRT989604	hsa-miR-582-5p	CLIP-seq
MIRT1993312	hsa-miR-604	CLIP-seq
MIRT989605	hsa-miR-607	CLIP-seq
MIRT1993313	hsa-miR-608	CLIP-seq
MIRT989607	hsa-miR-615-5p	CLIP-seq
MIRT989609	hsa-miR-634	CLIP-seq
MIRT989610	hsa-miR-637	CLIP-seq
MIRT1993315	hsa-miR-647	CLIP-seq
MIRT989612	hsa-miR-661	CLIP-seq
MIRT1993316	hsa-miR-663	CLIP-seq
MIRT1993318	hsa-miR-665	CLIP-seq
MIRT1993319	hsa-miR-761	CLIP-seq
MIRT989616	hsa-miR-924	CLIP-seq
MIRT989617	hsa-miR-935	CLIP-seq
MIRT989504	hsa-miR-1224-3p	CLIP-seq
MIRT989505	hsa-miR-1260	CLIP-seq
MIRT989506	hsa-miR-1260b	CLIP-seq
MIRT989508	hsa-miR-1280	CLIP-seq
MIRT989509	hsa-miR-1286	CLIP-seq
MIRT989515	hsa-miR-15a	CLIP-seq
MIRT989516	hsa-miR-15b	CLIP-seq
MIRT989517	hsa-miR-16	CLIP-seq
MIRT989518	hsa-miR-195	CLIP-seq
MIRT989521	hsa-miR-3065-3p	CLIP-seq
MIRT989528	hsa-miR-3195	CLIP-seq
MIRT989535	hsa-miR-3687	CLIP-seq
MIRT989540	hsa-miR-3945	CLIP-seq
MIRT989542	hsa-miR-424	CLIP-seq
MIRT989552	hsa-miR-4436b-3p	CLIP-seq
MIRT989553	hsa-miR-4442	CLIP-seq
MIRT989584	hsa-miR-4743	CLIP-seq
MIRT989594	hsa-miR-497	CLIP-seq
MIRT989533	hsa-miR-3657	CLIP-seq
MIRT989548	hsa-miR-4299	CLIP-seq
MIRT989555	hsa-miR-4456	CLIP-seq
MIRT989571	hsa-miR-4660	CLIP-seq
MIRT989600	hsa-miR-548q	CLIP-seq
MIRT989533	hsa-miR-3657	CLIP-seq
MIRT989548	hsa-miR-4299	CLIP-seq
MIRT989555	hsa-miR-4456	CLIP-seq
MIRT989571	hsa-miR-4660	CLIP-seq
MIRT989600	hsa-miR-548q	CLIP-seq
MIRT989500	hsa-miR-101	CLIP-seq
MIRT989503	hsa-miR-1207-5p	CLIP-seq
MIRT989512	hsa-miR-144	CLIP-seq
MIRT989515	hsa-miR-15a	CLIP-seq
MIRT989516	hsa-miR-15b	CLIP-seq
MIRT989517	hsa-miR-16	CLIP-seq
MIRT989518	hsa-miR-195	CLIP-seq
MIRT989525	hsa-miR-3150b-3p	CLIP-seq
MIRT989531	hsa-miR-3591-3p	CLIP-seq
MIRT989542	hsa-miR-424	CLIP-seq
MIRT989545	hsa-miR-4294	CLIP-seq
MIRT989565	hsa-miR-4635	CLIP-seq
MIRT989566	hsa-miR-4645-3p	CLIP-seq
MIRT989569	hsa-miR-4653-3p	CLIP-seq
MIRT989575	hsa-miR-4689	CLIP-seq
MIRT989578	hsa-miR-4698	CLIP-seq
MIRT989583	hsa-miR-4736	CLIP-seq
MIRT989586	hsa-miR-4763-3p	CLIP-seq
MIRT989589	hsa-miR-4784	CLIP-seq
MIRT989591	hsa-miR-4802-3p	CLIP-seq
MIRT989593	hsa-miR-495	CLIP-seq
MIRT989594	hsa-miR-497	CLIP-seq
MIRT989597	hsa-miR-513a-3p	CLIP-seq
MIRT989598	hsa-miR-526b	CLIP-seq
MIRT989599	hsa-miR-544b	CLIP-seq
MIRT989602	hsa-miR-571	CLIP-seq
MIRT989603	hsa-miR-578	CLIP-seq
MIRT989604	hsa-miR-582-5p	CLIP-seq
MIRT989605	hsa-miR-607	CLIP-seq
MIRT989612	hsa-miR-661	CLIP-seq
MIRT989616	hsa-miR-924	CLIP-seq
MIRT989617	hsa-miR-935	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
KLF5	Activation	18774944
SREBF1	Unknown	10520861;11790787;17449569

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0002064	Process	Epithelial cell development	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003824	Function	Catalytic activity	IEA
GO:0004312	Function	Fatty acid synthase activity	EXP	18455495
GO:0004312	Function	Fatty acid synthase activity	IBA
GO:0004312	Function	Fatty acid synthase activity	IEA
GO:0004313	Function	[acyl-carrier-protein] S-acetyltransferase activity	IDA	8962082
GO:0004313	Function	[acyl-carrier-protein] S-acetyltransferase activity	IEA
GO:0004314	Function	[acyl-carrier-protein] S-malonyltransferase activity	IEA
GO:0004315	Function	3-oxoacyl-[acyl-carrier-protein] synthase activity	IEA
GO:0004316	Function	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity	IDA	26851298
GO:0004316	Function	3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity	IEA
GO:0005515	Function	Protein binding	IPI	18022563, 23427160, 25959826, 27478939, 32296183, 32814053, 36604718
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17081065
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006084	Process	Acetyl-CoA metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IDA	7835891, 26851298
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	TAS	7835891
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0008611	Process	Ether lipid biosynthetic process	IEA
GO:0009888	Process	Tissue development	IEA
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0016297	Function	Fatty acyl-[ACP] hydrolase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0019171	Function	(3R)-hydroxyacyl-[acyl-carrier-protein] dehydratase activity	IDA	8962082
GO:0019171	Function	(3R)-hydroxyacyl-[acyl-carrier-protein] dehydratase activity	IEA
GO:0030223	Process	Neutrophil differentiation	IEA
GO:0030224	Process	Monocyte differentiation	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0031177	Function	Phosphopantetheine binding	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0042470	Component	Melanosome	IEA
GO:0042587	Component	Glycogen granule	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0044788	Process	Host-mediated perturbation of viral process	IDA	34320401
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046949	Process	Fatty-acyl-CoA biosynthetic process	TAS
GO:0061771	Process	Response to caloric restriction	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0090557	Process	Establishment of endothelial intestinal barrier	IEA
GO:0141148	Function	Enoyl-[acyl-carrier-protein] reductase (NADPH) activity	IEA

Other IDs

• MIM: 600212
• HGNC: 3594
• e!Ensembl: ENSG00000169710

Protein

• UniProt ID: P49327
• Protein name: Fatty acid synthase (EC 2.3.1.85) (Type I fatty acid synthase) [Includes: [Acyl-carrier-protein] S-acetyltransferase (EC 2.3.1.38); [Acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39); 3-oxoacyl-[acyl-carrier-protein] synthase (EC 2.3.1.41); 3-oxoac
• Protein function: Fatty acid synthetase is a multifunctional enzyme that catalyzes the de novo biosynthesis of long-chain saturated fatty acids starting from acetyl-CoA and malonyl-CoA in the presence of NADPH. This multifunctional protein contains 7 catalytic ac
• PDB: 1XKT, 2CG5, 2JFD, 2JFK, 2PX6, 3HHD, 3TJM, 4PIV, 4W82, 4W9N, 4Z49, 5C37, 6NNA, 7MHD, 7MHE, 8EYI, 8EYK, 8G7X, 8GKC, 8VF7, 8VG4, 8VLE, 8VLO, 8VLP, 8VM0, 8VM5, 8VM6, 8VM7, 8VMC, 8VMD, 9B7Z, 9B80, 9MJ9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00109	ketoacyl-synt	1 → 239	Beta-ketoacyl synthase, N-terminal domain	Domain
  PF02801	Ketoacyl-synt_C	243 → 360	Beta-ketoacyl synthase, C-terminal domain	Domain
  PF16197	KAsynt_C_assoc	362 → 472	Ketoacyl-synthetase C-terminal extension	Family
  PF00698	Acyl_transf_1	493 → 810	Acyl transferase domain	Domain
  PF14765	PS-DH	865 → 1108	Polyketide synthase dehydratase	Domain
  PF08242	Methyltransf_12	1243 → 1342	Methyltransferase domain	Domain
  PF00107	ADH_zinc_N	1679 → 1816	Zinc-binding dehydrogenase	Family
  PF08659	KR	1885 → 2065	KR domain	Family
  PF00550	PP-binding	2125 → 2192	Phosphopantetheine attachment site	Domain
  PF00975	Thioesterase	2242 → 2501	Thioesterase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Prominent expression in brain, lung, liver and mammary gland. {ECO:0000269|PubMed:7567999, ECO:0000269|PubMed:7595075}.
• Sequence:

  MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
  DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEAL
  SRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC
  PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLAR
  RVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
  DPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
  SPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPPPAPAPHATL
  PRLLRASGRTPEAVQKLLEQGLRHSQDLAFLSMLNDIAAVPATAMPFRGYAVLGGERGGP
  EVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLS
  TDESTFDDIVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAV
  LAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQAPVFE
  FVEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEA
  QWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPSCT
  IIPLMKKDHRDNLEFFLAGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL
  AWDVPAAEDFPNGSGSPSAAIYNIDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLA
  RALGLGVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSENGNLVVSGKVYQ
  WDDPDPRLFDHPESPTPNPTEPLFLAQAEVYKELRLRGYDYGPHFQGILEASLEGDSGRL
  LWKDNWVSFMDTMLQMSILGSAKHGLYLPTRVTAIHIDPATHRQKLYTLQDKAQVADVVV
  SRWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQL
  CKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQ
  VLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLL
  SPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVA
  ALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESL
  FSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSSRP
  VWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGD
  LVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVSTLTRGDLSSIRWVCSSLRHAQPTCPG
  AQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAK
  GLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGV
  GQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKG
  VDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFF
  NESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEE
  PEAVLKGAKPKLMSAISKTFCPAHKSYIIAGGLGGFGLELAQWLIQRGVQKLVLTSRSGI
  RTGYQAKQVRRWRRQGVQVQVSTSNISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDGLL
  ENQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSCGRGNAGQSNYGFANSA
  MERICEKRRHEGLPGLAVQWGAIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLN
  QPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSV
  EVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR
  SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLD
  SIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGS
  PTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAA
  VDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGA
  DYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

• Sequence length: 2511

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Autism spectrum disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLINODACTYLY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLINODACTYLY OF FINGERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epileptic encephalopathy	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOTROPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FASN-related disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEARING IMPAIRMENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIPOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYMPTOMS OF DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acne	Acne	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	17853317, 23305094		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	17853317		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	23305094		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	11245018		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12605660, 16010441, 17376892, 18552209, 18923451, 29680307, 9264377, 9573033, 9722299		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	12907599, 15159312, 24183913		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	10602414		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	7579353		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	7579353		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	10602414		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31058328		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	9852221		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	29763727		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10632348, 16343245, 19318631, 22723001, 28247971, 9486981		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15680394, 18802406		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	15680394, 21325951, 21390183, 9407969		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	17599056, 28400509, 9486981		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	16564913, 19318631, 29668854		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10547600, 15585555		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	15968727		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	10632348		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	33626208	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	10807785	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	9108407		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12605660, 17376892, 29680307, 9264377		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	16740746, 17487740, 20423996		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	11830507, 12507887, 15160902		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	9683272		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10190897, 11166462, 11342370, 12133900, 12613509, 17962369, 29721391, 9573032		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30648403		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	20394629, 23591741, 31741398		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	20394629, 23591741, 31741398		★☆☆☆☆ Found in Text Mining only
Alpers Syndrome (disorder)	Alpers Syndrome	BEFREE	10770536		★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	12608434	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15538542, 19766542, 29091582, 29343717	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	11129341		★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	17406980		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	11129341		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22155582		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	27069257, 7540067	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	20071543		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	23064941		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30189932		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	26910909, 30274084		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	32628088	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11167757, 11564081, 14617023, 9538630, 9580207	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	11380462	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	8929361	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	31191551	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	28766840		★☆☆☆☆ Found in Text Mining only
Anemia, Splenic	Anemia	CTD_human_DG	15877736		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23393225, 30375637		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	19189648, 20973802		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	22949932	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30271190, 30823540		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30271190, 30823540		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17350784	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	29611722, 9580207		★☆☆☆☆ Found in Text Mining only
Aplastic anemia, idiopathic	Anemia	BEFREE	29611722		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	31202106		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	28665611		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31622668		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22687048	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26763436		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	26763436	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	20462799, 36362342	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	7747803	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10088775, 10403282, 10817565, 12296865, 12746897, 12855687, 15457448, 16508940, 16646028, 17360386, 20187936, 21155991, 24452947, 29880835, 33042152, 34239365, 36934132, 37667923, 38046263, 9022077, 9333124, 9764613	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10225817	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	10704078, 10710535, 12234263, 17460949, 30864351	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11207646, 12234263, 23241113		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24641294	Inhibit	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16187021		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19740103	Associate	★☆☆☆☆ Found in Text Mining only
Asymmetric crying face association	Asymmetric crying face association	BEFREE	27081834		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	11096418, 30189932		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	22649200, 24603338	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11407740, 17053166, 21646352	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31622668		★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	9852221		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	11171836, 11641530, 18383830	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	21651830	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21651830		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	15929764, 17493146		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	LHGDN	17493146		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10513797, 10807785, 10840834, 11454987, 12353035, 12516573, 14585083, 15557123, 16271851, 17724145, 19770844, 22299671, 23591741, 26907631, 27837196, 27845235, 28060213, 28078597, 29611722, 29686686, 30565243, 30702213, 31072029, 31301931, 31618754, 31840751, 8806292, 8929361, 9028957, 9108407, 9826578, 9862736, 9922038, 9927496		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	10513814, 10515860, 10632670, 10807785, 11454987, 12081238, 12149230, 12199788, 12516573, 12855571, 12855687, 12930371, 15178337, 15870181, 16108814, 16720836, 17350784, 17724145, 19950259, 21233219, 22971828, 26076826, 27846610, 29686686, 7531628, 8929361, 9108407, 9129034, 9151896, 9373236	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	12220552, 15929764		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	22536412, 2545777, 26590112		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	10513797, 24760111, 9927496	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	10090885, 10200300, 10340403, 10358758, 10403307, 10497009, 10515860, 10575548, 10691859, 10709732, 10802504, 10807785, 10931153, 11397650, 11588044, 11830507, 11895618, 12139945, 12215906, 12657942, 12736807, 12819469, 15140060, 15160902, 15459302, 15492869, 16257267, 16271851, 16291365, 16446975, 17062728, 17336828, 17517660, 17605793, 17724145, 17725802, 18070632, 18223337, 18948840, 19176318, 20216376, 20360470, 21063026, 21109225, 21183786, 21183795, 21233219, 21447005, 21490157, 21724465, 21885602, 22157362, 22197557, 22237435, 22752343, 22918222, 23430113, 23524443, 24043286, 24398331, 25174872, 26323380, 26334989, 26453583, 26563159, 26907631, 27060458, 27770190, 27845235, 27846610, 28579554, 28668589, 29073495, 29296752, 29345341, 29686686, 29864493, 29911256, 30386345, 7540117, 8929361, 9028321, 9028957, 9108407, 9722073, 9787134, 9811346		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	UNIPROT_DG	10090885, 10340403, 10515860, 11418480, 17336828, 20935634, 7540117, 8929361, 9028321, 9028957, 9322534, 9821419, 9927496		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	10090885, 10200300, 10340403, 10487849, 10513797, 10515860, 10691859, 10709732, 10807785, 10931153, 11342444, 11380411, 11418480, 11588044, 11830507, 11918552, 12149230, 12199788, 12930371, 14592838, 15140060, 15459302, 15459303, 15870181, 16720836, 17062728, 17517660, 17724145, 17725802, 17999750, 19176318, 20216376, 20360470, 21063026, 21183786, 21183795, 21233219, 21490157, 21885602, 22237435, 22983577, 23054345, 23840885, 23850805, 24101757, 24398331, 24760111, 24894771, 25174872, 26907631, 27060458, 27099149, 27846610, 29686686, 31114586, 31191551, 31309545, 31689275, 32599613, 33170215, 33375216, 33995372, 34187243, 34438083, 35476126, 35628184, 36466883, 37838774, 7540117, 8642249, 8787672, 8929361, 9028321, 9108407, 9136951, 9695976, 9787134, 9811346, 9845544, 9927496	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	CTD_human_DG	15877736, 17674358		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	ORPHANET_DG	21885602, 22983577		★☆☆☆☆ Found in Text Mining only
Autoimmune lymphoproliferative syndrome	Autoimmune Lymphoproliferative Disorder	Orphanet			★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	GENOMICS_ENGLAND_DG	26258116		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome Type 1, Autosomal Dominant	Lymphoproliferative Disorder	CTD_human_DG	15877736, 17674358		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	CTD_human_DG	15877736, 17674358		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome Type 2B	Autoimmune Lymphoproliferative Disorder	BEFREE	29911256		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome, Type IA	Autoimmune Lymphoproliferative Disorder	BEFREE	10200300, 12657942, 15870181		★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome, Type IA	Autoimmune Lymphoproliferative Disorder	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	29250672		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	BEFREE	19146781, 24665877		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10720140, 11291062, 11697638, 11929130, 12952224, 19751723, 21885601, 24811343, 28509416, 30467847, 31262890, 9815617		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17487740		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10520003		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15680394, 21325951, 9407969		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	16049281, 19471962, 20934723	Associate	★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	19719835		★☆☆☆☆ Found in Text Mining only
	Behcet Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	15986355, 16164710, 26136352		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	15986355, 8814751	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	ORPHANET_DG	26136352		★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	BEFREE	23879478		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	20373869		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	23064941		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	15794670	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28029429		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14972509, 15514684, 16538171, 21922386, 22076446, 23948181, 24815844, 29453645, 29567231, 30221356		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	9070496		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	10500825		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	15287939, 9333124	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	27846610	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	11342425, 14617023, 9792306	Associate	★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	28588696		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	37395036	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	17241480	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11584892, 27601165		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20501759, 26858129, 8878461	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	24094130		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10200578, 10228495, 10381625, 10547600, 10640988, 10737707, 11291062, 12221075, 12517789, 12531699, 12706862, 14999148, 15094777, 15390078, 15583825, 15870086, 16740734, 16809439, 17089011, 17183065, 17352212, 17539658, 17565694, 17631500, 17653900, 17786307, 17962219, 18253084, 18281474, 18281512, 18376827, 19116881, 19252981, 19562667, 19885560, 20531416, 20665104, 20973802, 21080941, 21643005, 22177475, 23142364, 23326385, 23979975, 23982110, 24185967, 24248546, 24520215, 24596388, 25292037, 25472583, 26334757, 26488758, 26985864, 27291048, 27713175, 27714708, 27940354, 28121628, 28240737, 28386750, 28598289, 28922023, 28993998, 28994018, 29031197, 29282029, 29331414, 29344187, 30950543, 31164796, 31300609, 31497225, 31804351, 7896458, 8647960, 9815604		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17089011, 18281512		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10364198, 10391843, 10574967, 10651943, 11070347, 11786482, 12221075, 12223126, 12788915, 14625298, 15870086, 16048908, 17352212, 17352235, 17565694, 17631500, 18253084, 18593367, 19116881, 19126655, 20204402, 2022639, 20336406, 21080941, 21131755, 21643005, 22842170, 22886728, 23326385, 24916571, 25472583, 25751270, 26334757, 26349913, 26488758, 26632252, 27270654, 27524883, 27713175, 27714708, 28121628, 29185091, 29282029, 29331414, 30875891, 31992798, 32210727, 32244364, 32698885, 32801705, 33335078, 33813001, 34179825, 34667110, 35165289, 37334575, 39792986, 40055794, 40133809, 40239877, 8022791	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18022396, 18507020, 24894151	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24916571, 34092611	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	37696831	Associate	★☆☆☆☆ Found in Text Mining only
Bright Disease	Bright Disease	CTD_human_DG	21880982		★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	27868136		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	10477698, 12139737, 1375228, 1375849, 27641442, 28509416, 37569852, 7595225, 8695856, 9733827	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	27641442, 28509416		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	25151963	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10638979, 11857317, 12651942, 12941126, 15864586, 15937082, 16091761, 17597021, 18679533, 19358283, 20222173, 22485149, 23280017, 23725225, 26617948, 26823709, 27713175, 38003694	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16224150	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10547600, 11568974, 11857317, 12939396, 15459486, 15577743, 15585555, 17882277, 17904792, 19189648, 20973802, 22653145, 23142364, 23604035, 23982110, 28224267, 28247971, 29751678, 30597641, 30875891, 30950543, 31122252, 9815604		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	11005209	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	16638418, 32382535, 8691726, 9389732	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	12173320	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	10735508, 11315506, 12861043, 14669310, 15849812, 16080799, 16855382, 18679533, 20173757, 21288283, 22949843, 23427160, 23874836, 24761872, 25085585, 25543761, 25596532, 25826294, 27357947, 28246474, 30176945, 32536483, 33602168, 34311471, 34981667, 35283421, 37673328, 7502684, 8701982, 8929361, 9022073	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27758890	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	20228782	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	12173320	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	18469794	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14972509, 15514684, 16538171, 20380574, 21922386, 22076446, 24815844, 29453645, 29567231, 30221356		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10381625, 10656451, 12466971, 15937082, 16186185, 16437213, 16969344, 17014925, 23506616, 25225287, 27939887, 28320962, 28575806, 29306075		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	15710431, 17465232, 37868997	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	12173320	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19723916, 36650542	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10782148, 10839301, 10999463, 12460460, 12941126, 15188008, 19920202, 19940360, 28984208, 31097685, 37467634, 37626050	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10620127, 11121139, 15698511, 18949744, 19517019, 21808135, 25976983, 34879004	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	11355943	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	11857317, 19719835, 22677152, 9421463		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15806173, 17308072, 20505730, 20713491, 21442130, 21970855, 24979135, 25302649, 25947066, 27272793, 29569717, 30619288		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	11940212		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	10716473, 10920071, 17943461		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	16168288	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	10716473, 10920071, 17943461		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	10201613	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	30338905	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	10218621		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	17943461, 26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	17943461, 26670611		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26547721		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19718569, 24393375, 32231389	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	14991945, 30050538		★☆☆☆☆ Found in Text Mining only
Central nervous system demyelination	Central Nervous System Demyelination	BEFREE	24964076		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	10513797, 35633176	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12515395		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15289903, 16186185, 16515587, 18068525, 23900676, 24114012, 25472583, 27899077, 28279307		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	15289903, 16515587, 18068525, 23900676, 24114012, 25472583, 27899077, 28279307		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11378579, 12605660, 17376892, 20232432, 22211869, 24218069, 29680307, 7539514, 9264377		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	19047119		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	9683272		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	10482689, 10573518		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	11854917, 15794670, 29089545, 36635270, 37821935	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29089545	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	10201750		★☆☆☆☆ Found in Text Mining only
Christ-Siemens-Touraine syndrome	Hypohidrotic Ectodermal Dysplasia, X-Linked	BEFREE	21724465		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28231583		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10520003, 11891278, 12068792, 16741250, 20882050, 25670628, 29255346, 7680614		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	11891278, 16358967		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	23770605, 26956414, 28165464		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASDB_DG	23770605		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28261298		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	17493146, 22352690, 7595193		★☆☆☆☆ Found in Text Mining only
Coffin-Siris syndrome	Coffin-Siris Syndrome	BEFREE	10487849		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28763376		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22542159		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	16049281, 19653342	Associate	★☆☆☆☆ Found in Text Mining only
Coloboma	Coloboma	Pubtator	8814751	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10744679, 12865931, 15365741, 17585452, 18955444, 19790197, 26136424, 28260110, 28300842, 9652761		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10097131, 10744679, 10941902, 11477113, 11761438, 12865931, 15831912, 15864586, 16273638, 19341712, 20039457, 28260110, 9223329	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12137598, 15365741, 16273638, 18955444		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23604035	Inhibit	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	9652761		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10638979, 11082286, 17350669, 17687193, 18253084, 18955444, 19298528, 19412426, 19491830, 19790197, 20507599, 21723078, 22199270, 22218925, 22266115, 23725225, 24510238, 25605245, 26109148, 26759270, 27139420, 27622714, 28929494, 29130104, 29872506, 30154249, 31118685, 31262909		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10079247, 10098769, 10638979, 11173732, 11300326, 11896073, 15494722, 16273638, 17436592, 18253084, 18364356, 18516290, 18609706, 19266094, 19298528, 19358283, 19483104, 19790197, 20573240, 21071349, 22312135, 22389673, 23615374, 23725225, 24935584, 25292014, 25605245, 25970773, 26759270, 27139420, 28260110, 28268248, 28300842, 28929494, 30127519, 34253805, 34879004, 36129915, 36430738, 37202390, 37416772, 9006336, 9652761, 9895372, 9990295	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15274324, 9472684	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16000573, 16474169, 17559541, 17603079		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18955444, 32155177	Stimulate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	10403927		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	10403927, 11472434	Associate	★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	7554385	Stimulate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	27262945		★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	BEFREE	29805506		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	29089545	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10839301, 12460460, 16261161, 20572163, 31097685		★☆☆☆☆ Found in Text Mining only
Coombs positive hemolytic anemia	Coombs Positive Hemolytic Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Corneal Dystrophies Hereditary	Corneal dystrophy	Pubtator	14502125, 20680100, 21135107	Associate	★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	BEFREE	14502125, 21135107		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy epithelial basement membrane	Corneal dystrophy	Pubtator	20680100	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21286777, 26922070		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	11882051	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21286777, 26922070		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	28796044	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21286777, 26922070, 28796044, 30569262		★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	18445624, 19950259		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	15479684, 19653342, 31663908, 36916302	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	16472594		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	18782871		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	18782871	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Fibrous Histiocytoma	Fibrous Histiocytoma	BEFREE	12037686		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	10362803, 16538172, 24964211, 28654463		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	10567629, 12000003, 28106773	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	18685642		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14872492, 28971463, 29976400, 31762289		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	18078642		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	8976190	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26186532, 28594820, 30271190		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	27232630	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	12542799, 30286163	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	7521376	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	16388717, 22778762	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28434120, 30286163, 31622668		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28094869		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	40185395	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10907126, 26647383, 29213335, 31202106		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24262292	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10907126, 26647383, 29213335, 31202106		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	12060768, 28106773	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22519592, 9334358	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19543203	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24178789, 24393375, 29620215, 30024959, 33788629	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10907126, 28745504, 28951327, 30274071, 9813457		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	16123366		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16691186, 19543203, 30744100		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31323309		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12952224, 14982861, 16740746, 17487740, 20352431, 20423996, 21693768, 28509416, 29483509		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	9697985	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29237473		★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	19543203		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	31298959		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	24690069, 30066360, 30606056		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	10880045	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28206666, 28434120, 30286163, 31622668		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	40055794	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	15094777		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15094777, 16809439, 23306391, 24105476, 25472583		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	11994542, 17982483		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	15144342, 24105476, 28656791, 33577023, 35008502, 37305395, 40244177	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15806311, 29226157		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29226157, 30036894, 31566051	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	30443253		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	8642249, 9692873	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	27006531	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17308072		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	16740734, 20713491, 9714053		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16186185, 17561354, 22723001, 9605741		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16186185, 17561354, 22723001, 9605741		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16186185, 16394289, 17912028, 23921907, 24473454, 25085585, 26819081	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	17912028		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16394289, 17187659, 19471962, 20438666, 20934723, 21926110, 24473454, 36965032	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ewings sarcoma	Ewing sarcoma	BEFREE	16380506, 29563856		★☆☆☆☆ Found in Text Mining only
Exanthema	Exanthema	Pubtator	10513797	Associate	★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	11310821		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	LHGDN	17704785		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	18830996, 23110339, 24478438, 25474087, 29786745, 33096687, 36251517	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	24520215, 24677715, 25216251, 27997977, 28088781, 28103304, 28449683, 29093267, 29575055, 29644441, 31022865, 31110049, 31233505		★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	25474087	Stimulate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24874946, 31010354		★☆☆☆☆ Found in Text Mining only
Fibroadenoma of breast	Fibroadenoma Of Breast	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	11873109, 22352690, 31312992		★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	25169582		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	25169582	Associate	★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	28060213		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24587306		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	15968727	Associate	★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	17006606, 20074157, 30914315		★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	BEFREE	14982861		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	21864388	Associate	★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	18383830		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	20682655, 25333257	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16583360, 28442505		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	18941456	Associate	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	LHGDN	17161551		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	12466128, 31908105	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	12163388		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	19893031	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21148629		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	10948650	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	19043361		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31570110		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	LHGDN	18057579		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11519857, 11888910, 18171980, 18328427, 23064941, 27124583, 29159775, 29334602, 29453321, 31564969, 9600216		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18328427		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18594817, 24130787, 24561085, 26808816, 27124583, 34638742, 40133683, 9217971	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11519857, 11888910, 18171980, 18328427, 27124583, 29159775, 29334602, 29453321, 29535786, 31564969, 9499454		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10361224, 11050476, 11557035, 11770895, 11784850, 12496285, 18594817, 18710416, 22406992, 25556484, 26808816, 29164574, 34573317, 36602390, 7521890, 7537727, 8641993, 8878461, 9111585, 9217971, 9409814, 9472635	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10770630, 10980594, 14719118, 16969344, 24094130, 27601165, 7539458, 7540953, 9446703, 9670853		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	11949822, 12629150, 14530312, 14719118		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	10462254		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	CTD_human_DG	21880982		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	31323309		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	10192442, 11222367	Associate	★☆☆☆☆ Found in Text Mining only
Granular Dystrophy, Corneal	Corneal Granular Dystrophy	BEFREE	24129074		★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	9645360	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Slack Skin	Granulomatous Slack Skin	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	23235765		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	10780664, 11422195, 12930371, 16219172, 18324486, 19008632	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11101869, 14585083, 18972838		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	LHGDN	18162459, 18324486		★☆☆☆☆ Found in Text Mining only
Groenouw type I corneal dystrophy	Groenouw corneal dystrophy	Pubtator	20680100, 24129074	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	LHGDN	15748958		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	29432441		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	11005209, 12480911, 12930371, 18324486	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	11101869, 11245438, 27572459, 29250672, 31840751		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	16219172	Stimulate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	LHGDN	18324486, 18505906		★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	32628088	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	10201613	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	21935395, 22790687, 30272299	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	16507928, 30066360		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	11549589	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	20360470, 34187243	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11166462, 11697638, 17517660		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	11166462	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	CTD_human_DG	15877736		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	11697638, 17891181		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	10974022, 14617023	Associate	★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	12135676	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	10340403	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	10468853	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	30209179	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	10540162, 10930983, 18830996, 23427160, 27243827	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24478438, 28883690	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	10930983, 18679533	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	15457575	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10398166		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10716717, 12398896, 15235125	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18796435	Stimulate	★☆☆☆☆ Found in Text Mining only
Histiocytoma	Histiocytoma	BEFREE	12037686		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	10329597, 10340403, 11376869, 11830507, 11943736, 15078899, 15096587, 20216376, 27846610, 9054667, 9769119	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10340403, 10848834, 11376869, 11830507, 12507887, 15160902, 7572793, 8522287		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	11943736, 34802797	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	11972629	Inhibit	★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	18095312		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	10513797		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	Pubtator	10513797	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	26647383, 29088813, 29331414		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	22966071, 29088813, 31022865, 31164724, 31216433		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	18528705		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30031400, 30935037		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Primary	Hyperparathyroidism	Pubtator	27763797	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	10780664, 27763797	Associate	★☆☆☆☆ Found in Text Mining only
Hypersplenism	Hypersplenism	CTD_human_DG	15877736		★☆☆☆☆ Found in Text Mining only
Hypersplenism	Hypersplenism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17558734, 30171418	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27090298, 30864351	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17853317, 23337395, 27090298, 28974347, 30998123, 31083252, 31465767		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30338905		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	11278795		★☆☆☆☆ Found in Text Mining only
Hypoparathyroidism	Hypoparathyroidism	Pubtator	40185395	Associate	★☆☆☆☆ Found in Text Mining only
Hypopituitarism	Hypopituitarism	Pubtator	40185395	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30272292		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	30272292	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17118637, 18355682, 24927122	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31729368		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11334117, 23580232, 27218286	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23640463		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	38117249	Inhibit	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	24927122, 31002816		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	24927122, 35687490	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	12199788, 17725802		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	HPO_DG			★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	15806173, 19318631, 7500020		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16921240, 28763376		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	23218678	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	10225817	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15637757, 16439103		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	15637757, 19653342, 32519954	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20299470	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24178789, 30024959, 37111057	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	11473033		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	21937992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Interleukin 2 Receptor Alpha Deficiency of	Interleukin 2 receptor deficiency	Pubtator	9573033	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23205884		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27593829, 34925543, 35613904	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	34925543, 35613904	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Displacement	Intervertebral disc displacement	Pubtator	23141929	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	18383830	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	18473402	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	20140201		★☆☆☆☆ Found in Text Mining only
Intestinal Pseudo-Obstruction	Intestinal Pseudoobstruction	LHGDN	18582468		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36451838	Associate	★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	21114893	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	11824955		★☆☆☆☆ Found in Text Mining only
Juvenile pauciarticular chronic arthritis	Pauciarticular chronic arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	22431252, 31762289		★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	25169582		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	25169582	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16198418, 16304056, 8522287		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	17034587	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18609513		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28407629		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26477820		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19878707		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	19417161	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	18949744, 33415169	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23618817		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	28654693		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	28654693, 31754707	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10515651, 24218069, 29056104, 29680307, 30092310, 30565243, 9485194, 9722299		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10539881, 10556200, 11238127, 11675354, 11739185, 12149230, 12244143, 15102480, 17129359, 17376892, 17561974, 17673463, 18056484, 18403639, 18477771, 18923451, 19737931, 24218069, 28537657, 7579353, 7684622, 9013854, 9389707, 9533769, 9573032, 9573033	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15203866		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15699173	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	10601997, 7682455	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	35476232	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Mast Cell	Mast cell leukemia	Pubtator	16455983	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	10556200	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10539881, 11739185, 15203866, 19047119, 22733023, 33742137, 9012700, 9389707	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	11698395, 11918536, 22084312, 33742137	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	9845544		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10602414, 10812243, 11739185, 12907599, 15159312, 19047119, 24183913, 29526802		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	7579353		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	10190897, 11166462, 11342370, 12613509, 17962369, 18923451, 29721391, 9573032		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	LHGDN	12207908		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	25565205		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	20359312		★☆☆☆☆ Found in Text Mining only
Lhermitte-Duclos disease	Lhermitte-Duclos disease	BEFREE	21806408		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	19691458, 20359312, 23153021		★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	22775001		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	LHGDN	16368755		★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	22775001		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	8022791	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	18259941, 19116881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liposarcoma	Liposarcoma	Pubtator	18259941, 20372807	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
liposarcoma	Liposarcoma	CTD_human_DG	20372807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liposarcoma, Dedifferentiated	liposarcoma	CTD_human_DG	20372807		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Pleomorphic	liposarcoma	CTD_human_DG	20372807		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	CTD_human_DG	20372807		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10583438, 10692445, 11274632, 11692157, 11873109, 16855382, 17938571, 18830996, 20126469, 20173757, 20428769, 21147110, 21164560, 22676643, 23427160, 23613870, 24958469, 25231933, 25449696, 25723590, 25735330, 26476289, 26857837, 27264722, 27879277, 28027934, 28118080, 28197637, 28827398, 30824767, 30954949, 8946836, 9022073		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	11867183, 12883671		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	14563831, 15543204, 21147110		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16510204, 17493146, 22352690, 7595193		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	25543761, 9510393	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	21636249	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	7595193		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	10980054, 11099494, 18679533, 27243827	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	10540162, 18679533, 23114924, 24218069	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	28060213		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	8567993	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	LHGDN	12679613		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	CTD_human_DG	12828076		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	25601293, 26986512, 30700543, 7595193		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10583438, 10692445, 18830996, 20126469, 20173757, 21164560, 26476289, 28118080, 28197637, 30824767, 9022073		★☆☆☆☆ Found in Text Mining only
Lumbar disc disease	Lumbar Disc Disease	BEFREE	21806408		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	12414525, 15833141, 26617708, 9817169	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	21144722, 9817169	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	18445624		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10655513, 12824926, 14614329, 15736468, 15937082, 16186185, 17708363, 18757527, 21430781, 21768098, 22393947, 23506616, 24128051, 25227797, 28400509, 32963220, 38069382	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12037669, 12515624, 12824926, 14512182, 15937082, 17704746		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	15704653	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	9486981		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	19946036, 22299671		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	16638418, 26261624	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10225817, 10323442, 17034587, 17162369, 21398610, 26090500, 7531628	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10513797, 10632670, 11168009, 11171685, 16108814, 18050247, 18512812, 19180486, 19404947, 19644848, 24348139, 26076826, 27211902, 7510716, 8787672, 9754553, 9822266	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19946036		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	10402071, 10461479, 10513797, 10840834, 11171685, 11550967, 12064832, 12165544, 12516573, 15661884, 16163374, 18050247, 19946036, 20064083, 20394629, 21793106, 23053964, 23065220, 27050822, 29021794, 31840751, 7531628, 9041943, 9802928		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12064832, 12516573, 16808908		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	17034587	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	8587248	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19946036		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15052671	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25543761, 26936091, 27524883, 28032929	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27139420, 35597782	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	27918556		★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	LHGDN	12604424		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10362803, 11380411, 11418480, 11454987, 12199788, 14982861, 15009062, 15459303, 17090655, 17210689, 24398331, 29504848, 31689275, 39843653, 7684622, 8700902, 9163608, 9683298, 9722299, 9787134	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10403307, 11454987, 11598798, 11697638, 12950026, 14982861, 15160902, 17277134, 17548807, 19751723, 24398331, 26202984, 27060458, 7572793, 9815617		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	15160902, 17545588		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10782148, 39843653, 7519826, 7682455, 9787134, 9858217	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Primary Cutaneous Anaplastic Large Cell	Primary cutaneous anaplastic large cell lymphoma	Pubtator	11121138, 19890350	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12952224, 28509416		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	11697638		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11697638, 19390683, 20352431, 9787134		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	11697638, 20352431, 9787134		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	12359741, 18923451, 21036138, 21173302, 24862567, 25140833, 29675945		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	10770536, 7531628		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	LHGDN	11986289		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	10487849, 10807785, 15492869, 27770190, 29686686, 9533447, 9586634		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10515860, 11673559, 12149230, 29686686, 33170215, 8929361	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	LHGDN	15492869		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Male Germ Cell Tumor	Male Germ Cell Tumor	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10066095, 10770630, 29453321, 7539458, 7540953, 9670853		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22485149		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10200578, 10381625, 10547600, 10640988, 10694501, 10737707, 11291062, 12221075, 12517789, 12531699, 12706862, 14999148, 15390078, 15583825, 15870086, 16740734, 16809439, 17089011, 17183065, 17352212, 17539658, 17565694, 17653900, 17786307, 17962219, 18281474, 18281512, 18376827, 19116881, 19252981, 19562667, 19885560, 20531416, 20665104, 20973802, 21080941, 21643005, 22767439, 23142364, 23326385, 23979975, 23982110, 24185967, 24248546, 24520215, 24596388, 25292037, 25472583, 26334757, 26488758, 26985864, 27291048, 27713175, 27714708, 27940354, 28121628, 28240737, 28386750, 28427229, 28598289, 28922023, 28993998, 28994018, 29031197, 29282029, 29331414, 29344187, 30950543, 31164796, 31300609, 31497225, 31804351, 7896458, 8647960, 9815604		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17089011, 18281512		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16809439, 23306391, 24105476		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	15937082, 16186185, 17561354, 22723001, 9605741		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24587306		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28571744		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20505730, 23821378, 25543761, 26442469		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10381625, 10391683, 10656451, 12466971, 15937082, 16186185, 16437213, 17014925, 21044743, 21430781, 23506616, 25225287, 27939887, 28320962, 29306075		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19691458, 20359312, 23153021, 25944167		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15235125, 15806173, 20505730, 20713491, 21970855, 24979135, 25302649, 25947066, 27272793, 29569717, 30619288		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	21442130		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11683408, 28639885, 29061815, 29434218, 29434927, 30579733		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pharynx	Malignant Pharyngeal Neoplasm	BEFREE	17000697		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11004665, 11310821, 12798352, 12939396, 15556626, 15897909, 16564913, 16798056, 17667965, 18355682, 18635971, 18774944, 19318631, 20679621, 20965718, 21170507, 21557277, 22045666, 22127986, 23562839, 23741342, 24362464, 24424626, 25868764, 26934656, 27357679, 28143451, 28387458, 29466694, 29784665, 30559929, 30578319, 30955223, 31527721, 31772672, 31831821, 9067276		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	18624760		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11180161, 19565204, 21792914, 21864388, 22631677, 23042672, 23636796, 23681795, 23921907, 26514456, 26936091, 28339092, 29928446		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	10566680, 16452205		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	25944167		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10397246, 14972509, 15514684, 16538171, 20380574, 21922386, 22076446, 24815844, 29453645, 29567231, 30221356		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	9070496		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10228495, 10340403, 10362803, 10391683, 10807785, 10817504, 12517928, 12654257, 12839976, 12939396, 15235125, 15240787, 15523670, 15533929, 15577743, 15669079, 15897909, 15996722, 16061653, 16154299, 16271851, 16473667, 16515587, 16538171, 16583360, 17000697, 17183065, 17308072, 17352212, 17539658, 17561354, 17687193, 17708363, 17882277, 17904792, 18281474, 18355682, 19032940, 19168581, 19225810, 19565204, 19782152, 20043266, 20126469, 20137575, 20505730, 20604875, 20973802, 21044743, 21325951, 21390183, 21390503, 21970855, 22042271, 22116377, 22211869, 22485149, 22676643, 22723001, 22767439, 23208675, 23540716, 23741342, 23821378, 23944368, 24014103, 24200503, 24508804, 24510238, 24568648, 24690893, 24964211, 25085585, 25231933, 25302649, 25472762, 25565205, 25656654, 25670628, 25958981, 26109148, 27291048, 27531709, 27579768, 27865080, 27975143, 28078586, 28224267, 28273453, 28300842, 28427229, 28442505, 28447715, 28521443, 28615298, 28654693, 28726934, 28729415, 28848043, 28922023, 29063830, 29723075, 29779975, 30465055, 30741424, 30903104, 30977974, 31002816, 31095793, 31148369, 31176682, 31242243, 31299104, 31300609, 31422225, 31564969, 31676791, 31704550, 31747602, 31804351, 31811668, 9722299		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	20373869		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15289903, 16515587, 18068525, 23900676, 24114012, 25472583, 27899077, 28279307		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10744679, 15365741, 17585452, 18955444, 19790197, 28260110, 28300842, 9652761		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	20822829		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17089011, 18281512		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10228495, 10547600, 12788915, 16048908, 18281474, 19083124, 27714708, 30957286		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12531699, 12788915, 14977837, 15254710, 17183065, 17631500, 17962219, 18211286, 18281512		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17089011, 18281512		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17089011, 18281512		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	11468180, 22485149, 24457957		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	10797525, 29481902		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	17350669		★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel-gruber syndrome	Pubtator	10793071	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	9683272		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10318823, 10361224, 10362803, 10383736, 10497214, 10802053, 11121134, 11225993, 11511312, 12230495, 12672071, 15467715, 15492115, 16004605, 16306044, 16487513, 18234961, 18618109, 19725869, 21792879, 22077874, 30872676, 37072838, 37801083, 37857525	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	10362803, 10510093, 12140383, 14668794, 16487513, 16622680, 17762757, 17904792, 19910452, 20858462, 24964211, 27918556, 28654463, 30932943, 8583966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	LHGDN	12140383, 14668794, 18234961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	15920554	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	CTD_human_DG	18770866, 20805790, 21213365		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	37481560	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	10362803, 11857317, 19626699	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	11583945	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23879478, 24094130, 28489139		★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	26186532, 28594820, 30271190		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	10716717, 27090298, 33978191, 34526523, 35843982	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25565205, 30189932		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28654463, 29648538		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	15674420		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18765530, 23166734, 34620841	Associate	★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	28681715		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	21808135	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	11703382	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11454987, 14982861, 29481902		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10381522, 11101147, 11222356, 12036884, 15860671, 15963854, 17384201, 18543396, 21912642, 22838736, 27405696, 32840410, 7530506, 7540067, 7540069, 7544648, 8978296, 9163609, 9207432, 9373236, 9639523, 9763578, 9787134	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12952224, 18543396, 18593922, 19561642, 27069257, 29719586, 9163609, 9763578, 9922038		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10694840, 11238569, 12098516, 12188927, 12576232, 14625033, 15218339, 31228212, 31840751, 9521618		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	11238569, 12188927, 21437244, 31228212, 8879222, 8976190	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12742662, 12757469, 17970696, 18208868		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	12576232, 28967047		★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	22723941	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	20476668	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	28988748	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	15049785, 15454488, 9129034	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	CTD_human_DG	15169653		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis, Generalized	Myasthenia Gravis	CTD_human_DG	15169653		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis, Ocular	Myasthenia Gravis	CTD_human_DG	15169653		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	12060388, 28206666	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	11861273		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12512919, 23604035, 24183913, 26910909, 9713962		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10460607, 11861273, 15677568, 23604035, 26910909, 9792306, 9868964	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12646947		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10500825, 11166462		★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	10716473, 10920071, 17943461		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	11849855, 11970950, 14711179	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19262492, 30563615		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	27323110		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	19740320	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34462518	Inhibit	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	10929762, 23208675, 29228426, 32119704, 34546840, 35628510, 37217794	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16473667, 19895798, 20842669, 23208675, 29228426, 29968360, 31309112		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	20530413		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	9217971	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10071131, 10200578, 10228495, 10453076, 10468284, 10482689, 10510093, 10620127, 10679393, 10799856, 10817504, 11001528, 11059759, 11064454, 11121134, 11442750, 11519857, 11584892, 11692157, 11697638, 11929130, 12078897, 12466128, 12939396, 12952224, 14517844, 14592832, 14999148, 15069541, 15094777, 15390078, 15806173, 15897909, 16061660, 16195739, 16300755, 16452205, 16681723, 16740734, 16740746, 17183065, 17283163, 17350669, 17352212, 17539658, 17565694, 17600087, 17687193, 17762757, 17786307, 17882277, 17891181, 18253084, 18281474, 18528705, 18796435, 18802406, 19318631, 19412426, 19430421, 19491830, 19639174, 19885560, 20137575, 20308427, 20423996, 20505730, 20507599, 20564833, 20679621, 21044743, 21442130, 21723078, 21880625, 21922386, 21944480, 22042271, 22045666, 22127986, 22266115, 22485149, 23040493, 23064941, 23306391, 23540716, 23741342, 23894399, 23944368, 24122668, 24520215, 24603338, 24780723, 24979135, 25017943, 25108128, 25204737, 25351625, 25472762, 25543761, 25723590, 25751270, 25795228, 26858129, 26936091, 26985864, 27124583, 27272793, 27601165, 27602772, 27884752, 28058641, 28121628, 28159572, 28202364, 28268248, 28292742, 28510098, 28598289, 28654463, 28729415, 28765933, 29021794, 29032605, 29129771, 29723075, 29872506, 29928446, 30619288, 30684846, 30914315, 31083642, 31118679, 31118685, 31122252, 31198791, 31676791, 31747602, 31775585, 31811668, 8647960, 9407969, 9446703, 9486981, 9499454, 9641888, 9652761, 9683272, 9694158, 9722299		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	20373869		★☆☆☆☆ Found in Text Mining only
Neoplasms, Germ Cell and Embryonal	Neoplasm	LHGDN	12163388		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	CTD_human_DG	26590112		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	LHGDN	14739003		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	15345369		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10453076, 18836921, 19065652, 23951214, 9288794		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12841868, 14617634, 17962944, 23034519, 23951214, 25695505, 9096388, 9533769	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	15364960, 25695505, 35633176	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	9354463		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	29626307		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	28729415		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	15196258, 31191551	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	18819843	Stimulate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	27940354		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	23208675		★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	29250672		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	16142397, 19231010, 20929443, 24684403, 25474087, 28027934, 28146130, 28315901, 28771824, 28827398, 29345914, 29717275, 29786745, 30802722, 31110049		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	23127599		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10391683, 11641789, 11743657, 19240174, 20137575, 21044743, 25227797, 28443464, 29449326, 29541228, 31012280, 31122252, 31422225		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	23127599		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	25474087, 30921449, 31010354		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	15390078		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	15113941, 15138278, 15235125, 18955444, 19300427, 19876008, 19913854, 21840420, 22278432, 24178789, 24285872, 25474087, 27758890, 27768648, 28387458, 29620215, 30422702	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	15220220, 15235125, 19223519, 19300427, 19543203, 19876008, 20679621, 22767439, 23376793, 24203314, 24285872, 24584283, 26035182, 26035386, 28490236, 28726934, 31287803, 31492533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	17618104, 19543203, 26694359, 26763436	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	20299470, 30171418, 34526523	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	20882379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30538543		★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	19146781		★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	11741983	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	27229379		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	20359312		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	25976983	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	11508432, 12932288, 14872492, 37291167	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	31762289	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	12932288	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	23392773		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30383451, 30779961		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30779961		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15390286, 19911702, 20819644, 21287529, 23229760, 24366211, 25351625, 28565856, 29079708, 30931932, 31404800, 7542559, 9247301		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18090928		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	19066961, 19911702, 22502718, 22875006, 24595049, 25034529, 25674245, 27813492, 29045512, 33289496, 33405298, 34335109, 35566090, 38217543	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29569717		★☆☆☆☆ Found in Text Mining only
Ovarian Granulosa Cell Tumor	Ovarian Tumor	BEFREE	23235765		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10737707, 15806173, 20505730, 20713491, 21970855, 24979135, 25302649, 25947066, 27272793, 29569717, 30619288		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15645122		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	21442130		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11290551, 12637505, 16093247, 19910452, 19959214, 21970855, 22653145, 25151963, 25302649, 25433947, 25446129, 25947066, 28086243, 29910195, 32503653, 32913236, 37838774, 38003694, 39608974, 8824809	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15920554	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11683408, 28639885, 29061815, 29434218, 29434927, 30579733		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	11940212, 18802406, 29434927, 30375637		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	15670977		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10714630, 11115536, 12173320, 14583775, 16109447, 17695548, 19723916, 22670178, 24551298, 28639885, 37302809, 37625401, 37699334	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	11940212		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	9334358	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	11310825, 11889077	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	19723916	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	11310825		★☆☆☆☆ Found in Text Mining only
Panniculitis	Panniculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	10566680, 15350189, 18682509, 25824544		★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	21971214, 9144006	Associate	★☆☆☆☆ Found in Text Mining only
Parapsoriasis	Parapsoriasis	Pubtator	18923451	Associate	★☆☆☆☆ Found in Text Mining only
Parapsoriasis en Plaques	Parapsoriasis En Plaques	BEFREE	18923451		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	27763797	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	16129703		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	23054369, 28137779, 30271190		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	26236736	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	10974022, 12135676		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	24091913		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	16388717, 27868136, 7521376	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	15178337, 7521376	Associate	★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	10513797		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	10513797, 36741233	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	10513797		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	18350449, 26514456	Stimulate	★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	26774147		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	LHGDN	12824926		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Poliosis	Poliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polyarticular Juvenile Idiopathic Arthritis, Rheumatoid Factor Negative	Seronegative polyarthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
POLYCYSTIC KIDNEY DISEASE 3 WITH OR WITHOUT POLYCYSTIC LIVER DISEASE	Polycystic Kidney Disease With Or Without Polycystic Liver Disease	BEFREE	31772672		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	29339197		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35393909	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	15178337, 16384930	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	16384930		★☆☆☆☆ Found in Text Mining only
Popliteal pterygium syndrome	Popliteal Pterygium Syndrome	BEFREE	29540336		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16010441, 18552209, 18923451, 24603338, 9573033		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30206207		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	HPO_DG			★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	27069257		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	15929764		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	14592832		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	21937992		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11004665, 11568974, 12798352, 12939396, 15556626, 15609334, 15897909, 16564913, 16798056, 17667965, 18355682, 18635971, 18774944, 19318631, 20679621, 20965718, 21170507, 21557277, 22045666, 22127986, 23562839, 23741342, 24362464, 24424626, 25868764, 26934656, 27357679, 28143451, 28387458, 29466694, 29784665, 30559929, 30578319, 30955223, 31527721, 31831821, 9067276		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic Diseases	BEFREE	11310821		★☆☆☆☆ Found in Text Mining only
Prostatic Diseases	Prostatic disease	Pubtator	11310821	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	16309180, 16827116	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	11310821, 17203870	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	12124829	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	11310821, 12939396, 19318631		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10722700, 10839298, 11020350, 11384102, 12432255, 15533929, 15556626, 16207477, 17146477, 18355682, 18774944, 19362044, 20679621, 22127986, 22343504, 24391718, 24907642, 25085585, 25177021, 25679447, 25767870, 25868764, 26002551, 26716643, 28143451, 28387458, 29784665, 32139877, 32258129, 32655718, 33043786, 33780364, 35468964, 36327818, 38112617, 38593154	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12839976, 12963547, 14689581, 15556626, 17667965, 18838960, 19161534		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12939396, 15897909, 16564913, 18635971, 26934656, 28775317		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15870086	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32319557, 36650542	Stimulate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	8587248	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26763436		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	26763436	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	10704078, 17118637, 25137293	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30171418	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	12414525, 26617708	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	21573156		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	15833141, 9817169	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	17446527, 29475397, 31358769		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	24903614, 25501066	Associate	★☆☆☆☆ Found in Text Mining only
RAS-ASSOCIATED AUTOIMMUNE LEUKOPROLIFERATIVE DISORDER	Autoimmune Leukoproliferative Disorder	CLINVAR_DG	10090885, 10875918, 15459303, 21490157, 22237435, 23407489, 9927496		★☆☆☆☆ Found in Text Mining only
RAS-ASSOCIATED AUTOIMMUNE LEUKOPROLIFERATIVE DISORDER	Autoimmune Leukoproliferative Disorder	BEFREE	22918222		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	19228791		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28571744		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10839301, 12460460, 16261161, 20572163, 20948318		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	8587248		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	LHGDN	12414525		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	15161631, 26477820		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinitis	Retinitis	BEFREE	11564832		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29321376		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	15378505	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	23441619, 23974512, 25958981		★☆☆☆☆ Found in Text Mining only
Retrobulbar Neuritis	Retrobulbar Neuritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10461479, 10515651, 11550967, 12516573, 16508942, 19228791, 21879377, 23053964, 25645050		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18078642		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis, Systemic Juvenile	Rheumatoid arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	31465767		★☆☆☆☆ Found in Text Mining only
Rippling muscle disease	Rippling Muscle Disease	BEFREE	30699992		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	33843033	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	18223337, 18588573		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	LHGDN	18588573		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	18588573, 37863732	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	26376720	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	11571738		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	18506556	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	17695539, 22382690, 25025207, 9846984	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	18074150		★☆☆☆☆ Found in Text Mining only
SCAPULOPERONEAL MYOPATHY, X-LINKED DOMINANT	Scapuloperoneal Myopathy, X-Linked	BEFREE	20501759, 26858129		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22545112		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	22545112		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	30560506	Inhibit	★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	19950259	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	15188368	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	16108814, 19950259	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	LHGDN	12583439		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	24398331	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11039936, 24398331, 25574840, 28447715, 29866515, 31427815		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	32265901	Associate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	18923451	Inhibit	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	19759548		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	19759548, 27039262	Associate	★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	15958855		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	10446867	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11204278, 12528117, 14672901, 15692983, 17075845, 21128999, 25062418, 29504848, 37353767, 9844061	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	12447615		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	15178337, 9008237	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	16164710		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30171418	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30171418		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	30551620	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	8652825, 9060702	Stimulate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	20470393, 34564955	Associate	★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	23770605, 26956414, 28165464		★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	10340403, 9028321, 9927496	Associate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	23053964		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	29960293	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10620127, 11442750, 11857317, 15996722, 18528705, 20604875, 20607707, 22723001, 23894399, 24362464, 25129245, 29966661, 9950255		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	11836578, 12270344, 15907374, 18410580, 18528705, 18949744		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15240787, 17912028, 21926110		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	29379198		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15039212, 18225575, 19362044, 20501759, 23894399, 26400345, 28686330, 29966661, 32628088, 32961983, 37798436	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27628319	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34402100	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	23894399		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	25976983		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	10620127		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16543918, 17000697, 20501759, 22313388		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	17188392, 18830996, 19019483, 20929443, 22664476, 24603540, 24677715, 25216251, 25474087, 27222915, 27997977, 28088781, 28103304, 28449683, 29093267, 29459774, 29575055, 29644441, 29786745, 30179264, 31022865, 31110049, 31233505		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	BEFREE	24861996		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11180161, 15459486, 19565204, 21792914, 21864388, 22631677, 23042672, 23636796, 23681795, 26514456, 26936091, 28339092, 29928446		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	10858249, 14595120, 18383830	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	11895550, 18561948		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12439910, 12944556, 14605879, 15052671, 15991280, 20193111, 20222173, 21526501, 23921907, 24032591, 24065485, 24927122, 26514456, 26617948, 26811494, 26936091, 28000850, 31646566, 36124496, 37513656, 9045896	Associate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	23591741, 29735018		★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	GWASCAT_DG	23603761		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	18445624, 19950259, 23053964, 27992693, 31840751		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12096347, 12466128		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	12096347, 12466128		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Taste Disorders	Taste Disorders	CTD_human_DG	22536412		★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular Diseases	BEFREE	31476926		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	17643097	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	21509038	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	31191551, 8929361	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer Hurthle cell	Hurthle cell thyroid cancer	Pubtator	22135723	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	22135723	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10566680, 10945619, 16452205, 30278467		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	22135723	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	29250672		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	10566680, 11005209, 16452205		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17597021, 17598974, 17657791		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	11005209, 16452205, 17597021, 22135723, 29250672	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	10464273, 11675676, 19008632	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	10566680		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	12930371, 16219172, 29250672	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	12119549, 24861996		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	12608883		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25213330, 25751270, 29088795, 29751678, 30074275, 30875891		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25213330, 25751270, 28121628, 29751678, 30875891	Associate	★☆☆☆☆ Found in Text Mining only
Ulcer of esophagus	Ulcer Of Esophagus	BEFREE	10353883		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10896914, 16439103, 23371318, 9207274		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	11404388		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	11355943, 16101181, 19913990, 22517918, 26798188, 31054930, 32792852, 34819038, 35127296, 35392075, 35480865, 37919060, 38186002, 38218866, 39867879	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	21922386		★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16186185, 16343245, 16515587, 23280017, 25472583, 27765929, 27899077, 31198791, 32390360, 35507982, 40764609	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35597782	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	23040493, 27375065		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	LHGDN	18488389		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	26136352		★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	ORPHANET_DG	26136352		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	31006709		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	12148596		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	18548110		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	18548110	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	HPO_DG			★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	18548110		★☆☆☆☆ Found in Text Mining only
Vogt-Koyanagi-Harada disease	Vogt-Koyanagi-Harada Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	20103915	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	31894270	Associate	★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	10666201		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	19719835		★☆☆☆☆ Found in Text Mining only