FARP2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2)

Gene

• Entrez ID: 9855
• Gene name: FERM, ARH/RhoGEF and pleckstrin domain protein 2
• Gene symbol: FARP2
• Synonyms (NCBI Gene): FIR, FRG, PLEKHC3
• Chromosome: 2
• Chromosome location: 2q37.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT989450	hsa-miR-1225-5p	CLIP-seq
MIRT989451	hsa-miR-3150a-3p	CLIP-seq
MIRT989452	hsa-miR-3175	CLIP-seq
MIRT989453	hsa-miR-34a	CLIP-seq
MIRT989454	hsa-miR-34c-5p	CLIP-seq
MIRT989455	hsa-miR-449a	CLIP-seq
MIRT989456	hsa-miR-449b	CLIP-seq
MIRT989457	hsa-miR-4708-5p	CLIP-seq
MIRT989458	hsa-miR-939	CLIP-seq
MIRT1993225	hsa-miR-1827	CLIP-seq
MIRT1993226	hsa-miR-185	CLIP-seq
MIRT989451	hsa-miR-3150a-3p	CLIP-seq
MIRT989452	hsa-miR-3175	CLIP-seq
MIRT1993227	hsa-miR-3194-3p	CLIP-seq
MIRT1993228	hsa-miR-326	CLIP-seq
MIRT1993229	hsa-miR-330-5p	CLIP-seq
MIRT1993230	hsa-miR-4306	CLIP-seq
MIRT1993231	hsa-miR-4644	CLIP-seq
MIRT1993232	hsa-miR-4667-5p	CLIP-seq
MIRT1993233	hsa-miR-4700-5p	CLIP-seq
MIRT1993234	hsa-miR-637	CLIP-seq
MIRT989458	hsa-miR-939	CLIP-seq
MIRT2227101	hsa-miR-1207-5p	CLIP-seq
MIRT989450	hsa-miR-1225-5p	CLIP-seq
MIRT2227102	hsa-miR-1227	CLIP-seq
MIRT2227103	hsa-miR-1231	CLIP-seq
MIRT1993226	hsa-miR-185	CLIP-seq
MIRT989451	hsa-miR-3150a-3p	CLIP-seq
MIRT989452	hsa-miR-3175	CLIP-seq
MIRT1993227	hsa-miR-3194-3p	CLIP-seq
MIRT1993228	hsa-miR-326	CLIP-seq
MIRT1993229	hsa-miR-330-5p	CLIP-seq
MIRT989453	hsa-miR-34a	CLIP-seq
MIRT989454	hsa-miR-34c-5p	CLIP-seq
MIRT2227104	hsa-miR-4251	CLIP-seq
MIRT2227105	hsa-miR-4288	CLIP-seq
MIRT1993230	hsa-miR-4306	CLIP-seq
MIRT2227106	hsa-miR-4329	CLIP-seq
MIRT989455	hsa-miR-449a	CLIP-seq
MIRT989456	hsa-miR-449b	CLIP-seq
MIRT1993231	hsa-miR-4644	CLIP-seq
MIRT1993232	hsa-miR-4667-5p	CLIP-seq
MIRT2227107	hsa-miR-4687-3p	CLIP-seq
MIRT1993233	hsa-miR-4700-5p	CLIP-seq
MIRT2227108	hsa-miR-4763-3p	CLIP-seq
MIRT2227109	hsa-miR-632	CLIP-seq
MIRT1993234	hsa-miR-637	CLIP-seq
MIRT989458	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	12351724
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	ISS
GO:0005737	Component	Cytoplasm	IDA	12351724
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0016322	Process	Neuron remodeling	IDA	12351724
GO:0016601	Process	Rac protein signal transduction	IDA	12351724
GO:0022405	Process	Hair cycle process	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	ISS
GO:0033623	Process	Regulation of integrin activation	IEA
GO:0033623	Process	Regulation of integrin activation	ISS
GO:0048468	Process	Cell development	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS
GO:0071800	Process	Podosome assembly	IEA
GO:0071800	Process	Podosome assembly	ISS

Other IDs

• MIM: 617586
• HGNC: 16460
• e!Ensembl: ENSG00000006607

Protein

• UniProt ID: O94887
• Protein name: FERM, ARHGEF and pleckstrin domain-containing protein 2 (FERM domain-including RhoGEF) (FIR) (FERM, RhoGEF and pleckstrin domain-containing protein 2) (Pleckstrin homology domain-containing family C member 3) (PH domain-containing family C member 3)
• Protein function: Functions as a guanine nucleotide exchange factor that activates RAC1. May have relatively low activity. Plays a role in the response to class 3 semaphorins and remodeling of the actin cytoskeleton. Plays a role in TNFSF11-mediated osteoclast di
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09379	FERM_N	48 → 111	FERM N-terminal domain	Domain
  PF00373	FERM_M	127 → 234	FERM central domain	Domain
  PF09380	FERM_C	238 → 328	FERM C-terminal PH-like domain	Domain
  PF08736	FA	333 → 376	FERM adjacent (FA)	Family
  PF00621	RhoGEF	539 → 724	RhoGEF domain	Domain
  PF00169	PH	756 → 852	PH domain	Domain
  PF00169	PH	930 → 1026	PH domain	Domain

• Sequence:

  MGEIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
  EPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
  VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
  REHLKVNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
  GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
  GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
  KRIPYERRHSKTHTSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
  EFKDSSSSLTDPQVSYVKSPAAERRSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPS
  PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDCEEPRHKRVPADEAYFIV
  KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
  LALWEGPSKAHTKGSHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAV
  YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYSPGHHDYADCHDALKAITEVT
  TTLQHILIRLENLQKLTELQRDLVGIENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSD
  MLLYTSKGVAGTSHFRIRGLLPLQGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEK
  EKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVRSSLEGH
  GQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFF
  YKTHQDDYPLASLPLLGYSVSIPREADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEV
  IQGASSSAGRAPSIVQDGPQPSSGLEGMVRGKEE

• Sequence length: 1054

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLELITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOME 2Q37 DELETION SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, LYMPHOCYTIC, CHRONIC, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance; Likely benign	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autistic Disorder	Autism	BEFREE	19365831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	19365831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37940859	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34672420	Associate	★☆☆☆☆ Found in Text Mining only
Chromosome 2q37 deletion syndrome	2q37 Deletion Syndrome	CTD_human_DG	19365831		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20062064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CTD_human_DG	20062064		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASDB_DG	20062064, 23770605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	23770605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31304629		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24247407, 24307987	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26241176		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26241176		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36566214	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile nephropathic cystinosis (disorder)	Juvenile nephropathic cystinosis	BEFREE	3921756		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	BEFREE	22996664		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27094381	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24824848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26241176, 29796163		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GWASDB_DG	23535732		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29796163		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35354376	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Myopia	Myopia	Pubtator	36036911	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15517870, 25588744, 26241176, 29274368		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28335643, 29775807, 31735362		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36254233	Associate	★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	6693127		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	23535732, 29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	1390951		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27813279		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	23770605		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30980774		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25588744		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34868391	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34418989	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	GWASCAT_DG	27723757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations