FAM9A (family with sequence similarity 9 member A) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	171482
Gene name	Family with sequence similarity 9 member A
Gene symbol	FAM9A
Synonyms (NCBI Gene)	TEX39A
Chromosome	X
Chromosome location	Xp22.31
Summary	This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be a nuclear protein that is localized to the nucleolus, and has some similarity to a synaptonemal complex protein. Multiple alternatively

3

miRTarBase ID	miRNA	Experiments	Reference
MIRT988910	hsa-miR-1236	CLIP-seq
MIRT988911	hsa-miR-3545-3p	CLIP-seq
MIRT988912	hsa-miR-4257	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000795	Component	Synaptonemal complex	IBA
GO:0005515	Function	Protein binding	IPI	23455924, 28514442, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0007286	Process	Spermatid development	IBA
GO:0051321	Process	Meiotic cell cycle	IBA

MIM	HGNC	e!Ensembl
300477	18403	ENSG00000183304

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q8IZU1
Protein name	Protein FAM9A
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed exclusively in testis. {ECO:0000269\|PubMed:12213195}.
Sequence	MEPVGRKRSRKAAKAQLEAQVTAAQGATKEGSGIASNFPGQPTMEPVGRKRSRKAAKAQL EAQVRAAPAKKHTGKDPVRDECEERNPFTETREEDVTDEHGEREPFAEKDEHTGIHTMKL EHIAADIKKGLAAKREMIKIDKAAYRKTKNTIERALKKKQLKRQKRDYRHTRKLLNVLKE YIAEKQKDDEAEEAEAAAAAAEAAAAAEAAAAAAEVIVVEDEEEEEKEEEEEKEEEEEEG EEEGGGEEGEEGGGGGEGEETEEEEEEEEEEEEEEQIKAFQEKQKRWQQPTGVRSWRLRE MKPLLEQLLKAAKDTKDNYCIISSSEESELDN
Sequence length	332
Interactions	View interactions