FAM86C1P (family with sequence similarity 86 member C1, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 55199
Gene name Family with sequence similarity 86 member C1, pseudogene
Gene symbol FAM86C1P
Synonyms (NCBI Gene)
FAM86CFAM86C1
Chromosome 11
Chromosome location 11q13.4
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 23349634, 25416956, 32296183
GO:0008168 Function Methyltransferase activity IEA
GO:0016740 Function Transferase activity IEA
GO:0032259 Process Methylation IEA
GO:0032991 Component Protein-containing complex IDA 23349634
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616124 25561 ENSG00000158483
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NVL1
Protein name Putative protein FAM86C1P (EC 2.1.1.-) (Protein FAM86C)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14904 FAM86 6 → 54 Family of unknown function Family
Sequence 
MAPEENAGSELLLQSFKRRFLAARALRSFRWQSLEAKLRDSSDSELLRDILQKHEAVHTE
PLDELYEVLVETLMAKESTQGHRSYLLTCCIAQKPSCRWSGSCGGWLPAGSTSGLLNSTW
PLPSATQRCASCSPPSYAGLGSDGKRKLIMTRNCFPTESTWRWQS
Sequence length 165
Interactions View interactions

No strongly related genes found yet for FAM86C1P.

No additional diseases found yet through genes similar to FAM86C1P.