FAM72C (family with sequence similarity 72 member C)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 554282
Gene name Family with sequence similarity 72 member C
Gene symbol FAM72C
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1q21.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005829 Component Cytosol IBA
GO:0005829 Component Cytosol IDA
GO:0005829 Component Cytosol IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616853 30602 ENSG00000263513
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
H0Y354
Protein name Protein FAM72C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14976 FAM72 5 → 149 FAM72 protein Family
Sequence 
MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
FTKICKCKLKDIACLKCGNIVVYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGV
NVLLRGNLPEIEESTDEDVLNISAEECIR
Sequence length 149
Interactions View interactions

No strongly related genes found yet for FAM72C.

No additional diseases found yet through genes similar to FAM72C.