FAM27D1 (family with sequence similarity 27 member D1)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 724094
Gene name Family with sequence similarity 27 member D1
Gene symbol FAM27D1
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9p11.2
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 32015 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T7N8
Protein name Protein FAM27D1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15832 FAM27 28 → 118 Family
Sequence 
MLEKRLLRMGMRLQLLRDRRISSRGPGLHRAKADPQQQKRLTTGLMTQAETQKEAQQRQA
AMRKTALWHTGHLQPKTHTHTGMHTQTHRERERNTQRLRDRERRENGRHTHRHTHTLTHT
HTHRDTHTASYRRGIETHTTRQPLRLRGSAHDENDPRVREQPRGTQADLSSRSRMAARLL
GRLTPTNTVRAGLRLGSRAASPDPAWGFLIVVGPL
Sequence length 215
Interactions View interactions

No strongly related genes found yet for FAM27D1.

No additional diseases found yet through genes similar to FAM27D1.