FAM237B (family with sequence similarity 237 member B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 107986818
Gene name Family with sequence similarity 237 member B
Gene symbol FAM237B
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q21.13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1B0GVD1
Protein name Protein FAM237B
Protein function May be capable of activating GPR83 via the GNAQ signaling pathway.
Family and domains
Sequence 
MCFATRRWFYLHLGCMMLINLVNADFEFQKGVLASISPGITKDIDLQCWKACSLTLIDLK
ELKIEHNVDAFWNFMLFLQKSQRPGHYNVFLNIAQDFWDMYVDCLLSRSHGMGRRQVMPP
KYNFPQKITGGNLNVYLRE
Sequence length 139
Interactions View interactions

No strongly related genes found yet for FAM237B.

No additional diseases found yet through genes similar to FAM237B.