FAM237A (family with sequence similarity 237 member A)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 200726
Gene name Family with sequence similarity 237 member A
Gene symbol FAM237A
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2q33.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1B0GTK4
Protein name Protein FAM237A
Protein function May be capable of activating GPR83 via the GNAQ signaling pathway.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in the pituitary, testis, and heart and at lower levels in the brain. {ECO:0000269|PubMed:32713278}.
Sequence 
MADPGNRGGIHRPLSFTCSLLIVGMCCVSPFFCHSQTDLLALSQADPQCWESSSVLLLEM
WKPRVSNTVSGFWDFMIYLKSSENLKHGALFWDLAQLFWDIYVDCVLSRNHGLGRRQLVG
EEEKISAAQPQHTRSKQGTYSQLLRTSFLKKKELIEDLISMHVRRSGSSVIGKVNLEIKR
K
Sequence length 181
Interactions View interactions

No strongly related genes found yet for FAM237A.

No additional diseases found yet through genes similar to FAM237A.