FAM236D (family with sequence similarity 236 member D)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 105373251 |
| Gene name | Family with sequence similarity 236 member D |
| Gene symbol | FAM236D |
| Synonyms (NCBI Gene) |
FAM236C
|
| Chromosome | X |
| Chromosome location | Xq13.1 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A1B0GTK5 |
| Protein name | Protein FAM236D |
| Family and domains | |
| Sequence |
MIFTPFLPPADLSVFQNVKGPQKDPEELVAVSDTAEDPSSGTGLPREPALLRGSWRSRFQ |
| Sequence length | 79 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with FAM236D across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to FAM236D (see Related Genes above), that are NOT already directly curated for FAM236D itself -- a lead worth checking, not a confirmed association.
0
|
|