FAM223A (family with sequence similarity 223 member A)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 100132967 |
| Gene name | Family with sequence similarity 223 member A |
| Gene symbol | FAM223A |
| Synonyms (NCBI Gene) |
CXorf52LINC00204ANCRNA00204NCRNA00204ASPCX
|
| Chromosome | X |
| Chromosome location | Xq28 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q8IWN6 |
| Protein name | Protein FAM223A (SPCX) |
| Family and domains | |
| Sequence |
MYVQEHRLWGLMDKPHSAPCLMSLSLSFLICNKGRNAIRVQQSTDERMDAMLLWQCPTQG |
| Sequence length | 122 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with FAM223A across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to FAM223A (see Related Genes above), that are NOT already directly curated for FAM223A itself -- a lead worth checking, not a confirmed association.
0
|
|