FAM220BP (family with sequence similarity 220 member B, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 647044
Gene name Family with sequence similarity 220 member B, pseudogene
Gene symbol FAM220BP
Synonyms (NCBI Gene)
C9orf51
Chromosome 9
Chromosome location 9p13.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0005634 Component Nucleus IBA
GO:0097677 Function STAT family protein binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 23678 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B1ANY3
Protein name Putative protein FAM220BP (Protein FAM220B pseudogene)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15487 FAM220 2 → 247 FAM220 family Family
Sequence 
MRDRRGPLGTCLAQVQWAGGGDSDKLSYSLKKRMPTEGPWPADAPSWMNKPAVDGNSQSE
ALSLEMAGLSLPSGGPVLPYVKESARRNPASAATPSAAVGLFPAPTEYFARVSCSGVEAL
GRDWLGGGPRATHGHRGQCPKGEPRVSRLTRHQKLPEMGSFWDDPPSAFPSGLGSELEPS
CLHSILSATLHACPEVLLKDETKRIFLDLLNPMFSKQTIEFKKMFKSTSDGLQITLGLLA
LQHFELANSLCHSLKYKQNNASRLILRVVLE
Sequence length 271
Interactions View interactions

No strongly related genes found yet for FAM220BP.

No additional diseases found yet through genes similar to FAM220BP.