FAM215A (family with sequence similarity 215 member A)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 23591 |
| Gene name | Family with sequence similarity 215 member A |
| Gene symbol | FAM215A |
| Synonyms (NCBI Gene) |
APR-2C17orf88LINC00530
|
| Chromosome | 17 |
| Chromosome location | 17q21.31 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
|
|||||||||||||||||||||
|
|||||||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9Y5M1 |
| Protein name | Uncharacterized protein FAM215A (Apoptosis-related protein 2) (APR-2) |
| Family and domains | |
| Sequence |
MVSLWVEGTFPPPGFGLAHVACSGHGMKQKRKPASSEPTPEDALGGSAVPVRFHLHPEGL |
| Sequence length | 114 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with FAM215A across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to FAM215A (see Related Genes above), that are NOT already directly curated for FAM215A itself -- a lead worth checking, not a confirmed association.
0
|
|