FAM177A1 (family with sequence similarity 177 member A1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 283635
• Gene name: Family with sequence similarity 177 member A1
• Gene symbol: FAM177A1
• Synonyms (NCBI Gene): C14orf24, NEDWMG
• Chromosome: 14
• Chromosome location: 14q13.2
• Summary: This gene encodes a member of a conserved protein family. Alternative splicing results in multiple transcript variants. This gene is thought to be associated with susceptibility to juvenile idiopathic arthritis. [provided by RefSeq, Apr 2017]

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs730882244	->A	Likely-pathogenic	Coding sequence variant, frameshift variant

miRNA Show/Hide all (311)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020986	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT021622	hsa-miR-142-3p	Microarray	17612493
MIRT002702	hsa-miR-124-3p	Microarray	18668037
MIRT002702	hsa-miR-124-3p	Microarray	15685193
MIRT045179	hsa-miR-186-5p	CLASH	23622248
MIRT703690	hsa-miR-6513-3p	HITS-CLIP	23313552
MIRT628879	hsa-miR-1306-5p	HITS-CLIP	23313552
MIRT658426	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT628878	hsa-miR-4308	HITS-CLIP	23313552
MIRT628877	hsa-miR-4292	HITS-CLIP	23313552
MIRT628876	hsa-miR-6791-5p	HITS-CLIP	23313552
MIRT658425	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT628875	hsa-miR-7113-3p	HITS-CLIP	23313552
MIRT628874	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT658424	hsa-miR-4284	HITS-CLIP	23313552
MIRT658423	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT658422	hsa-miR-8057	HITS-CLIP	23313552
MIRT628879	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT658426	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT628878	hsa-miR-4308	HITS-CLIP	23824327
MIRT628877	hsa-miR-4292	HITS-CLIP	23824327
MIRT628876	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT658425	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT628875	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT628874	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT658424	hsa-miR-4284	HITS-CLIP	23824327
MIRT658423	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT658422	hsa-miR-8057	HITS-CLIP	23824327
MIRT628879	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT628878	hsa-miR-4308	HITS-CLIP	23824327
MIRT628877	hsa-miR-4292	HITS-CLIP	23824327
MIRT628876	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT628875	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT628874	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT628873	hsa-miR-1297	HITS-CLIP	23824327
MIRT628872	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT628871	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT628870	hsa-miR-4465	HITS-CLIP	23824327
MIRT557986	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT484263	hsa-miR-4711-3p	PAR-CLIP	21572407
MIRT484262	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT557985	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT557984	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT484259	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT484268	hsa-miR-8485	PAR-CLIP	23592263
MIRT484267	hsa-miR-329-3p	PAR-CLIP	23592263
MIRT484266	hsa-miR-362-3p	PAR-CLIP	23592263
MIRT484265	hsa-miR-603	PAR-CLIP	23592263
MIRT484264	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT484263	hsa-miR-4711-3p	PAR-CLIP	23592263
MIRT484262	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT484261	hsa-miR-3941	PAR-CLIP	23592263
MIRT484260	hsa-miR-1303	PAR-CLIP	23592263
MIRT484259	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT703690	hsa-miR-6513-3p	HITS-CLIP	23313552
MIRT628879	hsa-miR-1306-5p	HITS-CLIP	23313552
MIRT658426	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT628878	hsa-miR-4308	HITS-CLIP	23313552
MIRT628877	hsa-miR-4292	HITS-CLIP	23313552
MIRT628876	hsa-miR-6791-5p	HITS-CLIP	23313552
MIRT658425	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT628875	hsa-miR-7113-3p	HITS-CLIP	23313552
MIRT628874	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT658424	hsa-miR-4284	HITS-CLIP	23313552
MIRT658423	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT658422	hsa-miR-8057	HITS-CLIP	23313552
MIRT628879	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT658426	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT628878	hsa-miR-4308	HITS-CLIP	23824327
MIRT628877	hsa-miR-4292	HITS-CLIP	23824327
MIRT628876	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT658425	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT628875	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT628874	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT658424	hsa-miR-4284	HITS-CLIP	23824327
MIRT658423	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT658422	hsa-miR-8057	HITS-CLIP	23824327
MIRT628879	hsa-miR-1306-5p	HITS-CLIP	23824327
MIRT628878	hsa-miR-4308	HITS-CLIP	23824327
MIRT628877	hsa-miR-4292	HITS-CLIP	23824327
MIRT628876	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT628875	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT628874	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT628873	hsa-miR-1297	HITS-CLIP	23824327
MIRT628872	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT628871	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT628870	hsa-miR-4465	HITS-CLIP	23824327
MIRT557986	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT484263	hsa-miR-4711-3p	PAR-CLIP	21572407
MIRT484262	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT557985	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT557984	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT484259	hsa-miR-574-5p	PAR-CLIP	21572407
MIRT484268	hsa-miR-8485	PAR-CLIP	23592263
MIRT484267	hsa-miR-329-3p	PAR-CLIP	23592263
MIRT484266	hsa-miR-362-3p	PAR-CLIP	23592263
MIRT484265	hsa-miR-603	PAR-CLIP	23592263
MIRT484264	hsa-miR-511-3p	PAR-CLIP	23592263
MIRT484263	hsa-miR-4711-3p	PAR-CLIP	23592263
MIRT484262	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT484261	hsa-miR-3941	PAR-CLIP	23592263
MIRT484260	hsa-miR-1303	PAR-CLIP	23592263
MIRT484259	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT982177	hsa-miR-1206	CLIP-seq
MIRT982178	hsa-miR-1252	CLIP-seq
MIRT982179	hsa-miR-26a	CLIP-seq
MIRT982180	hsa-miR-26b	CLIP-seq
MIRT982181	hsa-miR-3149	CLIP-seq
MIRT982182	hsa-miR-3154	CLIP-seq
MIRT982183	hsa-miR-3180-5p	CLIP-seq
MIRT982184	hsa-miR-338-5p	CLIP-seq
MIRT982185	hsa-miR-3674	CLIP-seq
MIRT982186	hsa-miR-3974	CLIP-seq
MIRT982187	hsa-miR-4277	CLIP-seq
MIRT982188	hsa-miR-4732-5p	CLIP-seq
MIRT982189	hsa-miR-4735-5p	CLIP-seq
MIRT982190	hsa-miR-4775	CLIP-seq
MIRT982191	hsa-miR-4794	CLIP-seq
MIRT982192	hsa-miR-483-5p	CLIP-seq
MIRT982193	hsa-miR-513b	CLIP-seq
MIRT982194	hsa-miR-520a-5p	CLIP-seq
MIRT982195	hsa-miR-525-5p	CLIP-seq
MIRT982196	hsa-miR-587	CLIP-seq
MIRT982197	hsa-miR-590-3p	CLIP-seq
MIRT982198	hsa-miR-885-5p	CLIP-seq
MIRT982199	hsa-miR-122	CLIP-seq
MIRT982200	hsa-miR-1284	CLIP-seq
MIRT982201	hsa-miR-1289	CLIP-seq
MIRT982202	hsa-miR-3135b	CLIP-seq
MIRT982203	hsa-miR-3198	CLIP-seq
MIRT982204	hsa-miR-329	CLIP-seq
MIRT982205	hsa-miR-3652	CLIP-seq
MIRT982206	hsa-miR-3664-5p	CLIP-seq
MIRT982207	hsa-miR-4294	CLIP-seq
MIRT982208	hsa-miR-4309	CLIP-seq
MIRT982209	hsa-miR-4430	CLIP-seq
MIRT982210	hsa-miR-4534	CLIP-seq
MIRT982211	hsa-miR-4639-3p	CLIP-seq
MIRT982212	hsa-miR-4789-5p	CLIP-seq
MIRT982199	hsa-miR-122	CLIP-seq
MIRT1922032	hsa-miR-24	CLIP-seq
MIRT982202	hsa-miR-3135b	CLIP-seq
MIRT982205	hsa-miR-3652	CLIP-seq
MIRT982209	hsa-miR-4430	CLIP-seq
MIRT1991178	hsa-miR-106a	CLIP-seq
MIRT1991179	hsa-miR-106b	CLIP-seq
MIRT1991180	hsa-miR-1208	CLIP-seq
MIRT982199	hsa-miR-122	CLIP-seq
MIRT1991181	hsa-miR-1272	CLIP-seq
MIRT982200	hsa-miR-1284	CLIP-seq
MIRT982201	hsa-miR-1289	CLIP-seq
MIRT1991182	hsa-miR-150	CLIP-seq
MIRT1991183	hsa-miR-17	CLIP-seq
MIRT1991184	hsa-miR-198	CLIP-seq
MIRT1991185	hsa-miR-20a	CLIP-seq
MIRT1991186	hsa-miR-20b	CLIP-seq
MIRT1922032	hsa-miR-24	CLIP-seq
MIRT982179	hsa-miR-26a	CLIP-seq
MIRT982180	hsa-miR-26b	CLIP-seq
MIRT1991187	hsa-miR-302a	CLIP-seq
MIRT1991188	hsa-miR-302b	CLIP-seq
MIRT1991189	hsa-miR-302c	CLIP-seq
MIRT1991190	hsa-miR-302d	CLIP-seq
MIRT1991191	hsa-miR-302e	CLIP-seq
MIRT1991192	hsa-miR-3117-5p	CLIP-seq
MIRT982202	hsa-miR-3135b	CLIP-seq
MIRT1991193	hsa-miR-3159	CLIP-seq
MIRT982203	hsa-miR-3198	CLIP-seq
MIRT1991194	hsa-miR-330-3p	CLIP-seq
MIRT1991195	hsa-miR-3646	CLIP-seq
MIRT982205	hsa-miR-3652	CLIP-seq
MIRT1991196	hsa-miR-3663-3p	CLIP-seq
MIRT982206	hsa-miR-3664-5p	CLIP-seq
MIRT1991197	hsa-miR-3682-5p	CLIP-seq
MIRT1991198	hsa-miR-372	CLIP-seq
MIRT1991199	hsa-miR-373	CLIP-seq
MIRT1991200	hsa-miR-3934	CLIP-seq
MIRT1991201	hsa-miR-3973	CLIP-seq
MIRT1991202	hsa-miR-412	CLIP-seq
MIRT1991203	hsa-miR-4282	CLIP-seq
MIRT982207	hsa-miR-4294	CLIP-seq
MIRT1991204	hsa-miR-4301	CLIP-seq
MIRT982208	hsa-miR-4309	CLIP-seq
MIRT1991205	hsa-miR-4420	CLIP-seq
MIRT982209	hsa-miR-4430	CLIP-seq
MIRT982210	hsa-miR-4534	CLIP-seq
MIRT982211	hsa-miR-4639-3p	CLIP-seq
MIRT1991206	hsa-miR-4731-5p	CLIP-seq
MIRT1991207	hsa-miR-4760-3p	CLIP-seq
MIRT982212	hsa-miR-4789-5p	CLIP-seq
MIRT1991208	hsa-miR-4799-5p	CLIP-seq
MIRT1991209	hsa-miR-5095	CLIP-seq
MIRT1991210	hsa-miR-512-3p	CLIP-seq
MIRT1991211	hsa-miR-514	CLIP-seq
MIRT1991212	hsa-miR-514b-3p	CLIP-seq
MIRT1991213	hsa-miR-519d	CLIP-seq
MIRT1991214	hsa-miR-520a-3p	CLIP-seq
MIRT1991215	hsa-miR-520b	CLIP-seq
MIRT1991216	hsa-miR-520c-3p	CLIP-seq
MIRT1991217	hsa-miR-520d-3p	CLIP-seq
MIRT1991218	hsa-miR-520e	CLIP-seq
MIRT1991219	hsa-miR-520g	CLIP-seq
MIRT1991220	hsa-miR-520h	CLIP-seq
MIRT1991221	hsa-miR-548g	CLIP-seq
MIRT1991222	hsa-miR-552	CLIP-seq
MIRT982196	hsa-miR-587	CLIP-seq
MIRT1991223	hsa-miR-627	CLIP-seq
MIRT1991224	hsa-miR-656	CLIP-seq
MIRT982198	hsa-miR-885-5p	CLIP-seq
MIRT1991225	hsa-miR-93	CLIP-seq
MIRT1991226	hsa-miR-944	CLIP-seq
MIRT1991178	hsa-miR-106a	CLIP-seq
MIRT1991179	hsa-miR-106b	CLIP-seq
MIRT982177	hsa-miR-1206	CLIP-seq
MIRT2225227	hsa-miR-1207-3p	CLIP-seq
MIRT1991180	hsa-miR-1208	CLIP-seq
MIRT982199	hsa-miR-122	CLIP-seq
MIRT2225228	hsa-miR-127-5p	CLIP-seq
MIRT982201	hsa-miR-1289	CLIP-seq
MIRT1991182	hsa-miR-150	CLIP-seq
MIRT1991183	hsa-miR-17	CLIP-seq
MIRT2225229	hsa-miR-1976	CLIP-seq
MIRT1991185	hsa-miR-20a	CLIP-seq
MIRT1991186	hsa-miR-20b	CLIP-seq
MIRT1922032	hsa-miR-24	CLIP-seq
MIRT982179	hsa-miR-26a	CLIP-seq
MIRT982180	hsa-miR-26b	CLIP-seq
MIRT1991187	hsa-miR-302a	CLIP-seq
MIRT1991188	hsa-miR-302b	CLIP-seq
MIRT1991189	hsa-miR-302c	CLIP-seq
MIRT1991190	hsa-miR-302d	CLIP-seq
MIRT1991191	hsa-miR-302e	CLIP-seq
MIRT982202	hsa-miR-3135b	CLIP-seq
MIRT2225230	hsa-miR-3144-3p	CLIP-seq
MIRT2225231	hsa-miR-3156-3p	CLIP-seq
MIRT2225232	hsa-miR-3157-5p	CLIP-seq
MIRT982203	hsa-miR-3198	CLIP-seq
MIRT982184	hsa-miR-338-5p	CLIP-seq
MIRT2225233	hsa-miR-361-3p	CLIP-seq
MIRT982205	hsa-miR-3652	CLIP-seq
MIRT1991196	hsa-miR-3663-3p	CLIP-seq
MIRT982206	hsa-miR-3664-5p	CLIP-seq
MIRT1991198	hsa-miR-372	CLIP-seq
MIRT1991199	hsa-miR-373	CLIP-seq
MIRT1991200	hsa-miR-3934	CLIP-seq
MIRT1991202	hsa-miR-412	CLIP-seq
MIRT2225234	hsa-miR-4279	CLIP-seq
MIRT982207	hsa-miR-4294	CLIP-seq
MIRT1991204	hsa-miR-4301	CLIP-seq
MIRT982208	hsa-miR-4309	CLIP-seq
MIRT1991205	hsa-miR-4420	CLIP-seq
MIRT2225235	hsa-miR-4426	CLIP-seq
MIRT982209	hsa-miR-4430	CLIP-seq
MIRT982210	hsa-miR-4534	CLIP-seq
MIRT982211	hsa-miR-4639-3p	CLIP-seq
MIRT2225236	hsa-miR-4647	CLIP-seq
MIRT2225237	hsa-miR-4662b	CLIP-seq
MIRT2225238	hsa-miR-4722-3p	CLIP-seq
MIRT1991206	hsa-miR-4731-5p	CLIP-seq
MIRT2225239	hsa-miR-4740-3p	CLIP-seq
MIRT982212	hsa-miR-4789-5p	CLIP-seq
MIRT982191	hsa-miR-4794	CLIP-seq
MIRT2225240	hsa-miR-483-3p	CLIP-seq
MIRT1991209	hsa-miR-5095	CLIP-seq
MIRT1991210	hsa-miR-512-3p	CLIP-seq
MIRT1991213	hsa-miR-519d	CLIP-seq
MIRT1991214	hsa-miR-520a-3p	CLIP-seq
MIRT1991215	hsa-miR-520b	CLIP-seq
MIRT1991216	hsa-miR-520c-3p	CLIP-seq
MIRT1991217	hsa-miR-520d-3p	CLIP-seq
MIRT1991218	hsa-miR-520e	CLIP-seq
MIRT1991219	hsa-miR-520g	CLIP-seq
MIRT1991220	hsa-miR-520h	CLIP-seq
MIRT2225241	hsa-miR-548s	CLIP-seq
MIRT1991222	hsa-miR-552	CLIP-seq
MIRT982196	hsa-miR-587	CLIP-seq
MIRT2225242	hsa-miR-646	CLIP-seq
MIRT1991224	hsa-miR-656	CLIP-seq
MIRT2225243	hsa-miR-875-5p	CLIP-seq
MIRT982198	hsa-miR-885-5p	CLIP-seq
MIRT1991225	hsa-miR-93	CLIP-seq
MIRT982199	hsa-miR-122	CLIP-seq
MIRT982202	hsa-miR-3135b	CLIP-seq
MIRT982205	hsa-miR-3652	CLIP-seq
MIRT982209	hsa-miR-4430	CLIP-seq
MIRT982199	hsa-miR-122	CLIP-seq
MIRT2225229	hsa-miR-1976	CLIP-seq
MIRT1922032	hsa-miR-24	CLIP-seq
MIRT982179	hsa-miR-26a	CLIP-seq
MIRT982180	hsa-miR-26b	CLIP-seq
MIRT982202	hsa-miR-3135b	CLIP-seq
MIRT982205	hsa-miR-3652	CLIP-seq
MIRT2225234	hsa-miR-4279	CLIP-seq
MIRT982209	hsa-miR-4430	CLIP-seq
MIRT2225238	hsa-miR-4722-3p	CLIP-seq
MIRT2225239	hsa-miR-4740-3p	CLIP-seq
MIRT982199	hsa-miR-122	CLIP-seq
MIRT1922032	hsa-miR-24	CLIP-seq
MIRT982179	hsa-miR-26a	CLIP-seq
MIRT982180	hsa-miR-26b	CLIP-seq
MIRT982202	hsa-miR-3135b	CLIP-seq
MIRT982181	hsa-miR-3149	CLIP-seq
MIRT982205	hsa-miR-3652	CLIP-seq
MIRT982185	hsa-miR-3674	CLIP-seq
MIRT982209	hsa-miR-4430	CLIP-seq
MIRT982188	hsa-miR-4732-5p	CLIP-seq
MIRT982189	hsa-miR-4735-5p	CLIP-seq
MIRT982190	hsa-miR-4775	CLIP-seq
MIRT982191	hsa-miR-4794	CLIP-seq
MIRT982197	hsa-miR-590-3p	CLIP-seq
MIRT2680592	hsa-miR-767-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 32814053

Other IDs

• MIM: 619181
• HGNC: 19829
• e!Ensembl: ENSG00000151327

Protein

• UniProt ID: Q8N128
• Protein name: Protein FAM177A1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14774	FAM177	39 → 154	FAM177 family	Family

• Sequence:

  MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHF
  VSGETMEEYSTDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEK
  IASVLGISTPKYQYAIDEYYRMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPE
  TVISSSFVNVNFEMEGDSEVIMESKQNPVSVPP

• Sequence length: 213

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Dolichocephaly	Likely pathogenic	rs730882244	RCV000162180	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Likely pathogenic	rs730882244	RCV000162180	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Macrocephaly	Likely pathogenic	rs730882244	RCV000162180	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mild obesity	Likely pathogenic	rs730882244	RCV000162180	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (17)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	39023044	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	26482879, 35577104	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	29121268	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	Disgenet	25558065, 38767059	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET ALZHEIMERS DISEASE	—	GWAS catalog	39023044	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	39023044	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	26974007, 39885523	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	29121268	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	26974007	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	29121268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	29228969	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	GWASCAT_DG	26482879		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	29228969	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	20136554		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	36825008	Inhibit	★☆☆☆☆ Found in Text Mining only
Long narrow head	Dolichocephaly	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	29121268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26974007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

AQP12B 1 shared diseaseSclerosing cholangitis 2 shared evidence sourcesGWAS catalog (Ankylosing spondylitis), GWAS catalog (Sclerosing cholangitis) Related via 1 shared disease including Sclerosing cholangitis — evidence mostly GWAS catalog. GAL3ST2 1 shared diseaseSclerosing cholangitis 2 shared evidence sourcesGWAS catalog (Ankylosing spondylitis), GWAS catalog (Sclerosing cholangitis) Related via 1 shared disease including Sclerosing cholangitis — evidence mostly GWAS catalog. GLYAT 1 shared diseaseSclerosing cholangitis 2 shared evidence sourcesGWAS catalog (Ankylosing spondylitis), GWAS catalog (Sclerosing cholangitis) Related via 1 shared disease including Sclerosing cholangitis — evidence mostly GWAS catalog. KSR1 1 shared diseaseSclerosing cholangitis 2 shared evidence sourcesGWAS catalog (Ankylosing spondylitis), GWAS catalog (Sclerosing cholangitis) Related via 1 shared disease including Sclerosing cholangitis — evidence mostly GWAS catalog. LPXN 1 shared diseaseSclerosing cholangitis 2 shared evidence sourcesGWAS catalog (Ankylosing spondylitis), GWAS catalog (Sclerosing cholangitis) Related via 1 shared disease including Sclerosing cholangitis — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
AQP12B	1	["Sclerosing cholangitis"]	0	[]	2	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Sclerosing cholangitis)"]
GAL3ST2	1	["Sclerosing cholangitis"]	0	[]	2	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Sclerosing cholangitis)"]
GLYAT	1	["Sclerosing cholangitis"]	0	[]	2	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Sclerosing cholangitis)"]
KSR1	1	["Sclerosing cholangitis"]	0	[]	2	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Sclerosing cholangitis)"]
LPXN	1	["Sclerosing cholangitis"]	0	[]	2	["GWAS catalog (Ankylosing spondylitis)","GWAS catalog (Sclerosing cholangitis)"]

Diseases Linked via Similar Genes

Inflammatory bowel disease Linked via 5 of 5 related genesAQP12B, GAL3ST2, GLYAT, KSR1, LPXN Open angle glaucoma Linked via 2 of 5 related genesGLYAT, LPXN Asthma Linked via 1 of 5 related genesGAL3ST2 Cardiovascular disease Linked via 1 of 5 related genesGLYAT Rheumatoid arthritis Linked via 1 of 5 related genesKSR1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Inflammatory bowel disease	5	["AQP12B","GAL3ST2","GLYAT","KSR1","LPXN"]
Open angle glaucoma	2	["GLYAT","LPXN"]
Asthma	1	["GAL3ST2"]
Cardiovascular disease	1	["GLYAT"]
Rheumatoid arthritis	1	["KSR1"]