Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	338094
Gene name	Family with sequence similarity 151 member A
Gene symbol	FAM151A
Synonyms (NCBI Gene)	C1orf179
Chromosome	1
Chromosome location	-

miRTarBase ID	miRNA	Experiments	Reference
MIRT017107	hsa-miR-335-5p	Microarray	18185580
MIRT980848	hsa-miR-3136-3p	CLIP-seq
MIRT980849	hsa-miR-331-3p	CLIP-seq
MIRT980850	hsa-miR-4292	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003674	Function	Molecular_function	ND
GO:0005615	Component	Extracellular space	IBA
GO:0008150	Process	Biological_process	ND
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	12975309
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8WW52

Protein name

Protein FAM151A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10223	DUF2181	66 → 306	Uncharacterized conserved protein (DUF2181)	Family
PF10223	DUF2181	338 → 575	Uncharacterized conserved protein (DUF2181)	Family

Sequence

MVCREQLSKNQVKWVFAGITCVSVVVIAAIVLAITLRRPGCELEACSPDADMLDYLLSLG
QISRRDALEVTWYHAANSKKAMTAALNSNITVLEADVNVEGLGTANETGVPIMAHPPTIY
SDNTLEQWLDAVLGSSQKGIKLDFKNIKAVGPSLDLLRQLTEEGKVRRPIWINADILKGP
NMLISTEVNATQFLALVQEKYPKATLSPGWTTFYMSTSPNRTYTQAMVEKMHELVGGVPQ
RVTFPVRSSMVRAAWPHFSWLLSQSERYSLTLWQAASDPMSVEDLLYVRDNTAVHQVYYD
IFEPLLSQFKQLALNATRKPMYYTGGSLIPLLQLPGDDGLNVEWLVPDVQGSGKTATMTL
PDTEGMILLNTGLEGTVAENPVPIVHTPSGNILTLESCLQQLATHPGHWGIHLQIAEPAA
LRPSLALLARLSSLGLLHWPVWVGAKISHGSFSVPGHVAGRELLTAVAEVFPHVTVAPGW
PEEVLGSGYREQLLTDMLELCQGLWQPVSFQMQAMLLGHSTAGAIGRLLASSPRATVTVE
HNPAGGDYASVRTALLAARAVDRTRVYYRLPQGYHKDLLAHVGRN

Sequence length

585

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (7)
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes Genes most often co-reported with FAM151A across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for FAM151A.

Diseases Linked via Similar Genes Diseases curated for genes most similar to FAM151A (see Related Genes above), that are NOT already directly curated for FAM151A itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to FAM151A.

FAM151A (family with sequence similarity 151 member A)

Save This Analysis