Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	131408
Gene name	Family with sequence similarity 131 member A
Gene symbol	FAM131A
Synonyms (NCBI Gene)	C3orf40FLAT715PRO1378
Chromosome	3
Chromosome location	3q27.1

25 Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052028	hsa-let-7b-5p	CLASH	23622248
MIRT979993	hsa-miR-1257	CLIP-seq
MIRT979994	hsa-miR-3194-3p	CLIP-seq
MIRT979995	hsa-miR-3919	CLIP-seq
MIRT979996	hsa-miR-4520a-5p	CLIP-seq
MIRT979997	hsa-miR-4520b-5p	CLIP-seq
MIRT979998	hsa-miR-4756-3p	CLIP-seq
MIRT979999	hsa-miR-4790-3p	CLIP-seq
MIRT1990341	hsa-miR-3120-5p	CLIP-seq
MIRT1990342	hsa-miR-1251	CLIP-seq
MIRT1990343	hsa-miR-1291	CLIP-seq
MIRT1990344	hsa-miR-3183	CLIP-seq
MIRT1990345	hsa-miR-328	CLIP-seq
MIRT1990346	hsa-miR-4474-3p	CLIP-seq
MIRT1990347	hsa-miR-4723-3p	CLIP-seq
MIRT1990348	hsa-miR-581	CLIP-seq
MIRT1990349	hsa-miR-663b	CLIP-seq
MIRT979993	hsa-miR-1257	CLIP-seq
MIRT2224556	hsa-miR-3137	CLIP-seq
MIRT2224557	hsa-miR-4690-3p	CLIP-seq
MIRT2224558	hsa-miR-4717-3p	CLIP-seq
MIRT2224559	hsa-miR-4802-3p	CLIP-seq
MIRT2449132	hsa-miR-3121-3p	CLIP-seq
MIRT2449133	hsa-miR-4773	CLIP-seq
MIRT1990349	hsa-miR-663b	CLIP-seq

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6UXB0

Protein name

Protein FAM131A

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15010	FAM131	80 → 358	Putative cell signalling	Family

Sequence

MPMISVLGKMFLWQREGPGGRWTCQTSRRVSSDPAWAVEWIELPRGLSLSSLGSARTLRG
WSRSSRPSSVDSQDLPEVNVGDTVAMLPKSRRALTIQEIAALARSSLHGISQVVKDHVTK
PTAMAQGRVAHLIEWKGWSKPSDSPAALESAFSSYSDLSEGEQEARFAAGVAEQFAIAEA
KLRAWSSVDGEDSTDDSYDEDFAGGMDTDMAGQLPLGPHLQDLFTGHRFSRPVRQGSVEP
ESDCSQTVSPDTLCSSLCSLEDGLLGSPARLASQLLGDELLLAKLPPSRESAFRSLGPLE
AQDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSLDEDE
AEPEEQ

Sequence length

366

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
FAM131A-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Conn Syndrome	Conn Syndrome	CLINVAR_DG	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocortocoid-insensitive primary hyperaldosteronism	Glucocortocoid-Insensitive Hyperaldosteronism	CLINVAR_DG	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism, Familial, Type II	Hyperaldosteronism	CLINVAR_DG	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CLINVAR_DG	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with FAM131A across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for FAM131A.

Diseases Linked via Similar Genes Diseases curated for genes most similar to FAM131A (see Related Genes above), that are NOT already directly curated for FAM131A itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to FAM131A.

FAM131A (family with sequence similarity 131 member A)

Bookmark This Gene