FAM120A2P (family with sequence similarity 120A2, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 445577
Gene name Family with sequence similarity 120A2, pseudogene
Gene symbol FAM120A2P
Synonyms (NCBI Gene)
C9orf129bA165J3.3
Chromosome 9
Chromosome location 9q22.31
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT854144 hsa-miR-4452 CLIP-seq
MIRT854145 hsa-miR-520d-5p CLIP-seq
MIRT854146 hsa-miR-524-5p CLIP-seq
MIRT854147 hsa-miR-532-5p CLIP-seq
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 31116 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T035
Protein name Putative uncharacterized protein FAM120A2P (FAM120A2P pseudogene)
Family and domains
Sequence 
MPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKN
LTEQNSYSNIPHEGKHTPLYERSLPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGA
TKYTIYWGFRATDHHVQGRDSQARGTAAHWHGGHVCSPNVFWRISHGPAQQLTFPTEQAA
PPVCPAPASRRLSAPG
Sequence length 196
Interactions View interactions

No strongly related genes found yet for FAM120A2P.

No additional diseases found yet through genes similar to FAM120A2P.