Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55179
Gene name	Fas apoptotic inhibitory molecule
Gene symbol	FAIM
Synonyms (NCBI Gene)	FAIM1
Chromosome	3
Chromosome location	3q22.3
Summary	The protein encoded by this gene protects against death receptor-triggered apoptosis and regulates B-cell signaling and differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]

9 Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006650	hsa-miR-133b	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	22532850
MIRT021393	hsa-miR-9-5p	Sequencing	20371350
MIRT024307	hsa-miR-215-5p	Microarray	19074876
MIRT026322	hsa-miR-192-5p	Microarray	19074876
MIRT975466	hsa-miR-3613-5p	CLIP-seq
MIRT975467	hsa-miR-452	CLIP-seq
MIRT975468	hsa-miR-4676-3p	CLIP-seq
MIRT975469	hsa-miR-4693-5p	CLIP-seq
MIRT975470	hsa-miR-548m	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IBA

MIM	HGNC	e!Ensembl
617535	18703	ENSG00000158234

Q9NVQ4

Protein name

Fas apoptotic inhibitory molecule 1

Protein function

Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.

PDB

2KW1 , 3MX7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06905	FAIM1	2 → 177	Fas apoptotic inhibitory molecule (FAIM1)	Family

Sequence

MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAK
TKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDV
WCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS

Sequence length

179

Interactions

View interactions

Related Genes Genes most often co-reported with FAIM across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for FAIM.

Diseases Linked via Similar Genes Diseases curated for genes most similar to FAIM (see Related Genes above), that are NOT already directly curated for FAIM itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to FAIM.

FAIM (Fas apoptotic inhibitory molecule)

Save This Analysis