FABP9 (fatty acid binding protein 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 646480
Gene name Fatty acid binding protein 9
Gene symbol FABP9
Synonyms (NCBI Gene)
PERFPERF15T-FABPTLBP
Chromosome 8
Chromosome location 8q21.13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IBA
GO:0005829 Component Cytosol TAS
GO:0008289 Function Lipid binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620856 3563 ENSG00000205186
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q0Z7S8
Protein name Fatty acid-binding protein 9 (Testis lipid-binding protein) (TLBP) (Testis-type fatty acid-binding protein) (T-FABP)
PDB 4A60 , 7FY1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00061 Lipocalin 6 → 132 Lipocalin / cytosolic fatty-acid binding protein family Domain
Sequence 
MVEPFLGTWKLVSSENFEDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQD
TKISFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKM
NNIVSTRIYEKV
Sequence length 132
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Triglyceride catabolism

No strongly related genes found yet for FABP9.

No additional diseases found yet through genes similar to FABP9.