FABP5P3 (fatty acid binding protein 5 pseudogene 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 220832
Gene name Fatty acid binding protein 5 pseudogene 3
Gene symbol FABP5P3
Synonyms (NCBI Gene)
FABP5L3
Chromosome 7
Chromosome location 7q36.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005504 Function Fatty acid binding IBA
GO:0005634 Component Nucleus IBA
GO:0005829 Component Cytosol IBA
GO:0008289 Function Lipid binding IEA
GO:0015908 Process Fatty acid transport IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MUU1
Protein name Putative fatty acid-binding protein 5-like protein 3 (Fatty acid-binding protein 5 pseudogene 3)
Protein function High specificity for fatty acids.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00061 Lipocalin 2 → 100 Lipocalin / cytosolic fatty-acid binding protein family Domain
Sequence 
MGAMAKPDCIITCDSKNLTIKTESTLKTTQFSGTLGEKFEENTADGRRTQTVCNFTDGAL
VQHQEWDGKESTITRKLKDGKLVVERVMNHVACTRIYEKAQ
Sequence length 101
Interactions View interactions

No strongly related genes found yet for FABP5P3.

No additional diseases found yet through genes similar to FABP5P3.