Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	2152
Gene name	Coagulation factor III, tissue factor
Gene symbol	F3
Synonyms (NCBI Gene)	CD142TFTFA
Chromosome	1
Chromosome location	1p21.3
Summary	This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provi

777

Show/Hide all (777)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019927	hsa-miR-375	Microarray	20215506
MIRT020315	hsa-miR-130b-3p	Sequencing	20371350
MIRT022817	hsa-miR-124-3p	Microarray	18668037
MIRT028146	hsa-miR-93-5p	Sequencing	20371350
MIRT029798	hsa-miR-26b-5p	Microarray	19088304
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT477198	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028146	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT477192	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT477191	hsa-miR-4422	PAR-CLIP	20371350
MIRT477189	hsa-miR-3609	PAR-CLIP	20371350
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT477183	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT477177	hsa-miR-935	PAR-CLIP	20371350
MIRT477176	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT477198	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028146	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT477192	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT477191	hsa-miR-4422	PAR-CLIP	20371350
MIRT477189	hsa-miR-3609	PAR-CLIP	20371350
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT477183	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT477177	hsa-miR-935	PAR-CLIP	20371350
MIRT477176	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT477198	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028146	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT477192	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT477191	hsa-miR-4422	PAR-CLIP	20371350
MIRT477189	hsa-miR-3609	PAR-CLIP	20371350
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT477183	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT477179	hsa-miR-4476	PAR-CLIP	20371350
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT477177	hsa-miR-935	PAR-CLIP	20371350
MIRT477176	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT477198	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028146	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT477192	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT477191	hsa-miR-4422	PAR-CLIP	20371350
MIRT477189	hsa-miR-3609	PAR-CLIP	20371350
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT477183	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT477179	hsa-miR-4476	PAR-CLIP	20371350
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT477177	hsa-miR-935	PAR-CLIP	20371350
MIRT477176	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT477198	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028146	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT477192	hsa-miR-223-3p	PAR-CLIP	21572407
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT477191	hsa-miR-4422	PAR-CLIP	21572407
MIRT477189	hsa-miR-3609	PAR-CLIP	21572407
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT477183	hsa-miR-224-5p	PAR-CLIP	21572407
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT477179	hsa-miR-4476	PAR-CLIP	21572407
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT477177	hsa-miR-935	PAR-CLIP	21572407
MIRT477176	hsa-miR-508-3p	PAR-CLIP	21572407
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT477198	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028146	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT477192	hsa-miR-223-3p	PAR-CLIP	23446348
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT477191	hsa-miR-4422	PAR-CLIP	23446348
MIRT477189	hsa-miR-3609	PAR-CLIP	23446348
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT477183	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT477177	hsa-miR-935	PAR-CLIP	23446348
MIRT477176	hsa-miR-508-3p	PAR-CLIP	23446348
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT477198	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT028146	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT477192	hsa-miR-223-3p	PAR-CLIP	23592263
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	23592263
MIRT477191	hsa-miR-4422	PAR-CLIP	23592263
MIRT477189	hsa-miR-3609	PAR-CLIP	23592263
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT477183	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT477179	hsa-miR-4476	PAR-CLIP	23592263
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT477177	hsa-miR-935	PAR-CLIP	23592263
MIRT477176	hsa-miR-508-3p	PAR-CLIP	23592263
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT477198	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT477198	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT477198	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT477198	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT477198	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT477198	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	26701625
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	26701625
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	26701625
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	26701625
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	26701625
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	26701625
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	26701625
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	26701625
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT477192	hsa-miR-223-3p	PAR-CLIP	26701625
MIRT477192	hsa-miR-223-3p	PAR-CLIP	26701625
MIRT477192	hsa-miR-223-3p	PAR-CLIP	26701625
MIRT477192	hsa-miR-223-3p	PAR-CLIP	26701625
MIRT477192	hsa-miR-223-3p	PAR-CLIP	26701625
MIRT477192	hsa-miR-223-3p	PAR-CLIP	26701625
MIRT477183	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT477183	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT477183	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT477183	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT477183	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT477183	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT477189	hsa-miR-3609	PAR-CLIP	26701625
MIRT477189	hsa-miR-3609	PAR-CLIP	26701625
MIRT477189	hsa-miR-3609	PAR-CLIP	26701625
MIRT477189	hsa-miR-3609	PAR-CLIP	26701625
MIRT477189	hsa-miR-3609	PAR-CLIP	26701625
MIRT477189	hsa-miR-3609	PAR-CLIP	26701625
MIRT477191	hsa-miR-4422	PAR-CLIP	26701625
MIRT477191	hsa-miR-4422	PAR-CLIP	26701625
MIRT477191	hsa-miR-4422	PAR-CLIP	26701625
MIRT477191	hsa-miR-4422	PAR-CLIP	26701625
MIRT477191	hsa-miR-4422	PAR-CLIP	26701625
MIRT477191	hsa-miR-4422	PAR-CLIP	26701625
MIRT477179	hsa-miR-4476	PAR-CLIP	26701625
MIRT477179	hsa-miR-4476	PAR-CLIP	26701625
MIRT477179	hsa-miR-4476	PAR-CLIP	26701625
MIRT477179	hsa-miR-4476	PAR-CLIP	26701625
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	26701625
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	26701625
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	26701625
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	26701625
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT477176	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT477176	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT477176	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT477176	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT477176	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT477176	hsa-miR-508-3p	PAR-CLIP	26701625
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	26701625
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	26701625
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	26701625
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	26701625
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	26701625
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	26701625
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	26701625
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	26701625
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	26701625
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	26701625
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	26701625
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	26701625
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	26701625
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	26701625
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	26701625
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	26701625
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	26701625
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	26701625
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	26701625
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	26701625
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	26701625
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	26701625
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	26701625
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	26701625
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	26701625
MIRT477177	hsa-miR-935	PAR-CLIP	26701625
MIRT477177	hsa-miR-935	PAR-CLIP	26701625
MIRT477177	hsa-miR-935	PAR-CLIP	26701625
MIRT477177	hsa-miR-935	PAR-CLIP	26701625
MIRT477177	hsa-miR-935	PAR-CLIP	26701625
MIRT477177	hsa-miR-935	PAR-CLIP	26701625
MIRT028146	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028146	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028146	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028146	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028146	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028146	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT477198	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028146	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT477192	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT477191	hsa-miR-4422	PAR-CLIP	20371350
MIRT477189	hsa-miR-3609	PAR-CLIP	20371350
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT477183	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT477177	hsa-miR-935	PAR-CLIP	20371350
MIRT477176	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT477198	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028146	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT477192	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT477191	hsa-miR-4422	PAR-CLIP	20371350
MIRT477189	hsa-miR-3609	PAR-CLIP	20371350
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT477183	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT477177	hsa-miR-935	PAR-CLIP	20371350
MIRT477176	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT477198	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028146	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT477192	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT477191	hsa-miR-4422	PAR-CLIP	20371350
MIRT477189	hsa-miR-3609	PAR-CLIP	20371350
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT477183	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT477179	hsa-miR-4476	PAR-CLIP	20371350
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT477177	hsa-miR-935	PAR-CLIP	20371350
MIRT477176	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT477198	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028146	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT477192	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	20371350
MIRT477191	hsa-miR-4422	PAR-CLIP	20371350
MIRT477189	hsa-miR-3609	PAR-CLIP	20371350
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	20371350
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	20371350
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	20371350
MIRT477183	hsa-miR-224-5p	PAR-CLIP	20371350
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT477179	hsa-miR-4476	PAR-CLIP	20371350
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT477177	hsa-miR-935	PAR-CLIP	20371350
MIRT477176	hsa-miR-508-3p	PAR-CLIP	20371350
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT477198	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028146	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT477192	hsa-miR-223-3p	PAR-CLIP	21572407
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	21572407
MIRT477191	hsa-miR-4422	PAR-CLIP	21572407
MIRT477189	hsa-miR-3609	PAR-CLIP	21572407
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT477183	hsa-miR-224-5p	PAR-CLIP	21572407
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT477179	hsa-miR-4476	PAR-CLIP	21572407
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT477177	hsa-miR-935	PAR-CLIP	21572407
MIRT477176	hsa-miR-508-3p	PAR-CLIP	21572407
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT477198	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028146	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT477192	hsa-miR-223-3p	PAR-CLIP	23446348
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	23446348
MIRT477191	hsa-miR-4422	PAR-CLIP	23446348
MIRT477189	hsa-miR-3609	PAR-CLIP	23446348
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT477183	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	23446348
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	23446348
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	23446348
MIRT477177	hsa-miR-935	PAR-CLIP	23446348
MIRT477176	hsa-miR-508-3p	PAR-CLIP	23446348
MIRT477199	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT477198	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT477197	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT028146	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT477196	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT477195	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT477194	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT477193	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT477192	hsa-miR-223-3p	PAR-CLIP	23592263
MIRT477190	hsa-miR-6835-3p	PAR-CLIP	23592263
MIRT477191	hsa-miR-4422	PAR-CLIP	23592263
MIRT477189	hsa-miR-3609	PAR-CLIP	23592263
MIRT477188	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT477187	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT477186	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT477185	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT477184	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT477183	hsa-miR-224-5p	PAR-CLIP	23592263
MIRT477182	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT477181	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT477180	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT477179	hsa-miR-4476	PAR-CLIP	23592263
MIRT477178	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT477177	hsa-miR-935	PAR-CLIP	23592263
MIRT477176	hsa-miR-508-3p	PAR-CLIP	23592263
MIRT974524	hsa-miR-374c	CLIP-seq
MIRT974525	hsa-miR-520d-5p	CLIP-seq
MIRT974526	hsa-miR-524-5p	CLIP-seq
MIRT974527	hsa-miR-561	CLIP-seq
MIRT974528	hsa-miR-655	CLIP-seq
MIRT974529	hsa-miR-105	CLIP-seq
MIRT974530	hsa-miR-106a	CLIP-seq
MIRT974531	hsa-miR-106b	CLIP-seq
MIRT974532	hsa-miR-1182	CLIP-seq
MIRT974533	hsa-miR-128	CLIP-seq
MIRT974534	hsa-miR-1293	CLIP-seq
MIRT974535	hsa-miR-129-5p	CLIP-seq
MIRT974536	hsa-miR-1323	CLIP-seq
MIRT974537	hsa-miR-155	CLIP-seq
MIRT974538	hsa-miR-17	CLIP-seq
MIRT974539	hsa-miR-18a	CLIP-seq
MIRT974540	hsa-miR-18b	CLIP-seq
MIRT974541	hsa-miR-193a-5p	CLIP-seq
MIRT974542	hsa-miR-19a	CLIP-seq
MIRT974543	hsa-miR-19b	CLIP-seq
MIRT974544	hsa-miR-20a	CLIP-seq
MIRT974545	hsa-miR-20b	CLIP-seq
MIRT974546	hsa-miR-223	CLIP-seq
MIRT974547	hsa-miR-224	CLIP-seq
MIRT974548	hsa-miR-27a	CLIP-seq
MIRT974549	hsa-miR-27b	CLIP-seq
MIRT974550	hsa-miR-2964a-5p	CLIP-seq
MIRT974551	hsa-miR-3165	CLIP-seq
MIRT974552	hsa-miR-335	CLIP-seq
MIRT974553	hsa-miR-3545-3p	CLIP-seq
MIRT974554	hsa-miR-3613-5p	CLIP-seq
MIRT974555	hsa-miR-3622a-3p	CLIP-seq
MIRT974556	hsa-miR-3622b-3p	CLIP-seq
MIRT974557	hsa-miR-365	CLIP-seq
MIRT974558	hsa-miR-3669	CLIP-seq
MIRT974559	hsa-miR-371-5p	CLIP-seq
MIRT974560	hsa-miR-371b-5p	CLIP-seq
MIRT974561	hsa-miR-3926	CLIP-seq
MIRT974562	hsa-miR-3973	CLIP-seq
MIRT974563	hsa-miR-410	CLIP-seq
MIRT974564	hsa-miR-4252	CLIP-seq
MIRT974565	hsa-miR-4483	CLIP-seq
MIRT974566	hsa-miR-4509	CLIP-seq
MIRT974567	hsa-miR-455-5p	CLIP-seq
MIRT974568	hsa-miR-4658	CLIP-seq
MIRT974569	hsa-miR-4659a-5p	CLIP-seq
MIRT974570	hsa-miR-4659b-5p	CLIP-seq
MIRT974571	hsa-miR-4680-5p	CLIP-seq
MIRT974572	hsa-miR-4685-5p	CLIP-seq
MIRT974573	hsa-miR-4694-5p	CLIP-seq
MIRT974574	hsa-miR-4716-5p	CLIP-seq
MIRT974575	hsa-miR-4728-3p	CLIP-seq
MIRT974576	hsa-miR-4744	CLIP-seq
MIRT974577	hsa-miR-4758-5p	CLIP-seq
MIRT974578	hsa-miR-508-5p	CLIP-seq
MIRT974579	hsa-miR-519a	CLIP-seq
MIRT974580	hsa-miR-519d	CLIP-seq
MIRT974581	hsa-miR-520g	CLIP-seq
MIRT974582	hsa-miR-520h	CLIP-seq
MIRT974583	hsa-miR-544b	CLIP-seq
MIRT974584	hsa-miR-548ah	CLIP-seq
MIRT974585	hsa-miR-548n	CLIP-seq
MIRT974586	hsa-miR-548o	CLIP-seq
MIRT974587	hsa-miR-548s	CLIP-seq
MIRT974588	hsa-miR-548t	CLIP-seq
MIRT974589	hsa-miR-579	CLIP-seq
MIRT974590	hsa-miR-587	CLIP-seq
MIRT974591	hsa-miR-590-3p	CLIP-seq
MIRT974592	hsa-miR-607	CLIP-seq
MIRT974593	hsa-miR-630	CLIP-seq
MIRT974594	hsa-miR-873	CLIP-seq
MIRT974595	hsa-miR-93	CLIP-seq
MIRT1922031	hsa-miR-3121-3p	CLIP-seq
MIRT1988750	hsa-miR-1273e	CLIP-seq
MIRT1988751	hsa-miR-1285	CLIP-seq
MIRT974534	hsa-miR-1293	CLIP-seq
MIRT1988752	hsa-miR-1827	CLIP-seq
MIRT1988753	hsa-miR-200b	CLIP-seq
MIRT1988754	hsa-miR-200c	CLIP-seq
MIRT1988755	hsa-miR-217	CLIP-seq
MIRT1988756	hsa-miR-302f	CLIP-seq
MIRT1988757	hsa-miR-3122	CLIP-seq
MIRT1988758	hsa-miR-3166	CLIP-seq
MIRT1988759	hsa-miR-3187-5p	CLIP-seq
MIRT1988760	hsa-miR-3689a-3p	CLIP-seq
MIRT1988761	hsa-miR-3689c	CLIP-seq
MIRT974559	hsa-miR-371-5p	CLIP-seq
MIRT974560	hsa-miR-371b-5p	CLIP-seq
MIRT1988762	hsa-miR-3913-5p	CLIP-seq
MIRT1988763	hsa-miR-3929	CLIP-seq
MIRT1988764	hsa-miR-429	CLIP-seq
MIRT1988765	hsa-miR-4418	CLIP-seq
MIRT1988766	hsa-miR-4419b	CLIP-seq
MIRT1988767	hsa-miR-4478	CLIP-seq
MIRT974565	hsa-miR-4483	CLIP-seq
MIRT1988768	hsa-miR-451b	CLIP-seq
MIRT1988769	hsa-miR-4649-3p	CLIP-seq
MIRT1988770	hsa-miR-4661-5p	CLIP-seq
MIRT1988771	hsa-miR-4728-5p	CLIP-seq
MIRT1988772	hsa-miR-4761-5p	CLIP-seq
MIRT1988773	hsa-miR-4793-3p	CLIP-seq
MIRT1988774	hsa-miR-485-5p	CLIP-seq
MIRT974578	hsa-miR-508-5p	CLIP-seq
MIRT1988775	hsa-miR-509-3-5p	CLIP-seq
MIRT1988776	hsa-miR-509-5p	CLIP-seq
MIRT1988777	hsa-miR-612	CLIP-seq
MIRT1988778	hsa-miR-661	CLIP-seq
MIRT1988779	hsa-miR-766	CLIP-seq
MIRT974530	hsa-miR-106a	CLIP-seq
MIRT974531	hsa-miR-106b	CLIP-seq
MIRT974533	hsa-miR-128	CLIP-seq
MIRT1988751	hsa-miR-1285	CLIP-seq
MIRT974534	hsa-miR-1293	CLIP-seq
MIRT2223158	hsa-miR-130a	CLIP-seq
MIRT2223159	hsa-miR-130b	CLIP-seq
MIRT2223160	hsa-miR-148a	CLIP-seq
MIRT2223161	hsa-miR-148b	CLIP-seq
MIRT2223162	hsa-miR-152	CLIP-seq
MIRT974537	hsa-miR-155	CLIP-seq
MIRT974538	hsa-miR-17	CLIP-seq
MIRT1988752	hsa-miR-1827	CLIP-seq
MIRT974544	hsa-miR-20a	CLIP-seq
MIRT974545	hsa-miR-20b	CLIP-seq
MIRT1988755	hsa-miR-217	CLIP-seq
MIRT974546	hsa-miR-223	CLIP-seq
MIRT974547	hsa-miR-224	CLIP-seq
MIRT974548	hsa-miR-27a	CLIP-seq
MIRT974549	hsa-miR-27b	CLIP-seq
MIRT2223163	hsa-miR-301a	CLIP-seq
MIRT2223164	hsa-miR-301b	CLIP-seq
MIRT1988756	hsa-miR-302f	CLIP-seq
MIRT1988757	hsa-miR-3122	CLIP-seq
MIRT974551	hsa-miR-3165	CLIP-seq
MIRT1988758	hsa-miR-3166	CLIP-seq
MIRT1988759	hsa-miR-3187-5p	CLIP-seq
MIRT974555	hsa-miR-3622a-3p	CLIP-seq
MIRT974556	hsa-miR-3622b-3p	CLIP-seq
MIRT974557	hsa-miR-365	CLIP-seq
MIRT2223165	hsa-miR-3666	CLIP-seq
MIRT2223166	hsa-miR-3667-3p	CLIP-seq
MIRT1988760	hsa-miR-3689a-3p	CLIP-seq
MIRT1988761	hsa-miR-3689c	CLIP-seq
MIRT1988762	hsa-miR-3913-5p	CLIP-seq
MIRT1988763	hsa-miR-3929	CLIP-seq
MIRT974564	hsa-miR-4252	CLIP-seq
MIRT2223167	hsa-miR-4295	CLIP-seq
MIRT1988765	hsa-miR-4418	CLIP-seq
MIRT1988766	hsa-miR-4419b	CLIP-seq
MIRT1988767	hsa-miR-4478	CLIP-seq
MIRT974565	hsa-miR-4483	CLIP-seq
MIRT2223168	hsa-miR-454	CLIP-seq
MIRT1988769	hsa-miR-4649-3p	CLIP-seq
MIRT1988770	hsa-miR-4661-5p	CLIP-seq
MIRT1988771	hsa-miR-4728-5p	CLIP-seq
MIRT1988772	hsa-miR-4761-5p	CLIP-seq
MIRT1988773	hsa-miR-4793-3p	CLIP-seq
MIRT1988774	hsa-miR-485-5p	CLIP-seq
MIRT974578	hsa-miR-508-5p	CLIP-seq
MIRT1988775	hsa-miR-509-3-5p	CLIP-seq
MIRT1988776	hsa-miR-509-5p	CLIP-seq
MIRT974579	hsa-miR-519a	CLIP-seq
MIRT974580	hsa-miR-519d	CLIP-seq
MIRT974583	hsa-miR-544b	CLIP-seq
MIRT974584	hsa-miR-548ah	CLIP-seq
MIRT974589	hsa-miR-579	CLIP-seq
MIRT1988777	hsa-miR-612	CLIP-seq
MIRT1988778	hsa-miR-661	CLIP-seq
MIRT1988779	hsa-miR-766	CLIP-seq
MIRT974594	hsa-miR-873	CLIP-seq
MIRT974595	hsa-miR-93	CLIP-seq
MIRT974539	hsa-miR-18a	CLIP-seq
MIRT974540	hsa-miR-18b	CLIP-seq
MIRT974539	hsa-miR-18a	CLIP-seq
MIRT974540	hsa-miR-18b	CLIP-seq
MIRT974530	hsa-miR-106a	CLIP-seq
MIRT974531	hsa-miR-106b	CLIP-seq
MIRT974538	hsa-miR-17	CLIP-seq
MIRT974544	hsa-miR-20a	CLIP-seq
MIRT974545	hsa-miR-20b	CLIP-seq
MIRT974546	hsa-miR-223	CLIP-seq
MIRT974547	hsa-miR-224	CLIP-seq
MIRT974564	hsa-miR-4252	CLIP-seq
MIRT974579	hsa-miR-519a	CLIP-seq
MIRT974580	hsa-miR-519d	CLIP-seq
MIRT974584	hsa-miR-548ah	CLIP-seq
MIRT974595	hsa-miR-93	CLIP-seq
MIRT2449047	hsa-miR-3675-3p	CLIP-seq
MIRT2449048	hsa-miR-4684-5p	CLIP-seq
MIRT2449047	hsa-miR-3675-3p	CLIP-seq
MIRT2449048	hsa-miR-4684-5p	CLIP-seq
MIRT974530	hsa-miR-106a	CLIP-seq
MIRT974531	hsa-miR-106b	CLIP-seq
MIRT1988750	hsa-miR-1273e	CLIP-seq
MIRT1988751	hsa-miR-1285	CLIP-seq
MIRT974534	hsa-miR-1293	CLIP-seq
MIRT974538	hsa-miR-17	CLIP-seq
MIRT1988752	hsa-miR-1827	CLIP-seq
MIRT974539	hsa-miR-18a	CLIP-seq
MIRT974540	hsa-miR-18b	CLIP-seq
MIRT974544	hsa-miR-20a	CLIP-seq
MIRT974545	hsa-miR-20b	CLIP-seq
MIRT1988755	hsa-miR-217	CLIP-seq
MIRT974546	hsa-miR-223	CLIP-seq
MIRT974547	hsa-miR-224	CLIP-seq
MIRT1988756	hsa-miR-302f	CLIP-seq
MIRT1988757	hsa-miR-3122	CLIP-seq
MIRT974551	hsa-miR-3165	CLIP-seq
MIRT1988758	hsa-miR-3166	CLIP-seq
MIRT1988759	hsa-miR-3187-5p	CLIP-seq
MIRT2527049	hsa-miR-3613-3p	CLIP-seq
MIRT974555	hsa-miR-3622a-3p	CLIP-seq
MIRT974556	hsa-miR-3622b-3p	CLIP-seq
MIRT2449047	hsa-miR-3675-3p	CLIP-seq
MIRT1988760	hsa-miR-3689a-3p	CLIP-seq
MIRT1988761	hsa-miR-3689c	CLIP-seq
MIRT974559	hsa-miR-371-5p	CLIP-seq
MIRT974560	hsa-miR-371b-5p	CLIP-seq
MIRT1988762	hsa-miR-3913-5p	CLIP-seq
MIRT974561	hsa-miR-3926	CLIP-seq
MIRT1988763	hsa-miR-3929	CLIP-seq
MIRT974564	hsa-miR-4252	CLIP-seq
MIRT1988765	hsa-miR-4418	CLIP-seq
MIRT1988766	hsa-miR-4419b	CLIP-seq
MIRT2527050	hsa-miR-4426	CLIP-seq
MIRT2527051	hsa-miR-4432	CLIP-seq
MIRT1988767	hsa-miR-4478	CLIP-seq
MIRT974565	hsa-miR-4483	CLIP-seq
MIRT1988768	hsa-miR-451b	CLIP-seq
MIRT2527052	hsa-miR-4536	CLIP-seq
MIRT2527053	hsa-miR-4647	CLIP-seq
MIRT1988769	hsa-miR-4649-3p	CLIP-seq
MIRT2527054	hsa-miR-4662b	CLIP-seq
MIRT2449048	hsa-miR-4684-5p	CLIP-seq
MIRT2527055	hsa-miR-4696	CLIP-seq
MIRT1988771	hsa-miR-4728-5p	CLIP-seq
MIRT1988772	hsa-miR-4761-5p	CLIP-seq
MIRT1988773	hsa-miR-4793-3p	CLIP-seq
MIRT1988774	hsa-miR-485-5p	CLIP-seq
MIRT974578	hsa-miR-508-5p	CLIP-seq
MIRT1988775	hsa-miR-509-3-5p	CLIP-seq
MIRT1988776	hsa-miR-509-5p	CLIP-seq
MIRT974579	hsa-miR-519a	CLIP-seq
MIRT974580	hsa-miR-519d	CLIP-seq
MIRT974583	hsa-miR-544b	CLIP-seq
MIRT974584	hsa-miR-548ah	CLIP-seq
MIRT974587	hsa-miR-548s	CLIP-seq
MIRT1988777	hsa-miR-612	CLIP-seq
MIRT1988778	hsa-miR-661	CLIP-seq
MIRT1988779	hsa-miR-766	CLIP-seq
MIRT974594	hsa-miR-873	CLIP-seq
MIRT974595	hsa-miR-93	CLIP-seq
MIRT2527056	hsa-miR-933	CLIP-seq
MIRT974530	hsa-miR-106a	CLIP-seq
MIRT974531	hsa-miR-106b	CLIP-seq
MIRT1988751	hsa-miR-1285	CLIP-seq
MIRT974534	hsa-miR-1293	CLIP-seq
MIRT974536	hsa-miR-1323	CLIP-seq
MIRT974537	hsa-miR-155	CLIP-seq
MIRT974538	hsa-miR-17	CLIP-seq
MIRT974539	hsa-miR-18a	CLIP-seq
MIRT974540	hsa-miR-18b	CLIP-seq
MIRT2680441	hsa-miR-1976	CLIP-seq
MIRT974544	hsa-miR-20a	CLIP-seq
MIRT974545	hsa-miR-20b	CLIP-seq
MIRT1988755	hsa-miR-217	CLIP-seq
MIRT974546	hsa-miR-223	CLIP-seq
MIRT974547	hsa-miR-224	CLIP-seq
MIRT974550	hsa-miR-2964a-5p	CLIP-seq
MIRT1988757	hsa-miR-3122	CLIP-seq
MIRT974551	hsa-miR-3165	CLIP-seq
MIRT1988759	hsa-miR-3187-5p	CLIP-seq
MIRT2527049	hsa-miR-3613-3p	CLIP-seq
MIRT974555	hsa-miR-3622a-3p	CLIP-seq
MIRT974556	hsa-miR-3622b-3p	CLIP-seq
MIRT2449047	hsa-miR-3675-3p	CLIP-seq
MIRT1988760	hsa-miR-3689a-3p	CLIP-seq
MIRT1988761	hsa-miR-3689c	CLIP-seq
MIRT974559	hsa-miR-371-5p	CLIP-seq
MIRT974560	hsa-miR-371b-5p	CLIP-seq
MIRT1988762	hsa-miR-3913-5p	CLIP-seq
MIRT974561	hsa-miR-3926	CLIP-seq
MIRT974564	hsa-miR-4252	CLIP-seq
MIRT1988765	hsa-miR-4418	CLIP-seq
MIRT2527050	hsa-miR-4426	CLIP-seq
MIRT2527051	hsa-miR-4432	CLIP-seq
MIRT974565	hsa-miR-4483	CLIP-seq
MIRT1988768	hsa-miR-451b	CLIP-seq
MIRT2527052	hsa-miR-4536	CLIP-seq
MIRT2527053	hsa-miR-4647	CLIP-seq
MIRT2527054	hsa-miR-4662b	CLIP-seq
MIRT2449048	hsa-miR-4684-5p	CLIP-seq
MIRT2527055	hsa-miR-4696	CLIP-seq
MIRT974575	hsa-miR-4728-3p	CLIP-seq
MIRT1988771	hsa-miR-4728-5p	CLIP-seq
MIRT1988772	hsa-miR-4761-5p	CLIP-seq
MIRT1988773	hsa-miR-4793-3p	CLIP-seq
MIRT974578	hsa-miR-508-5p	CLIP-seq
MIRT1988775	hsa-miR-509-3-5p	CLIP-seq
MIRT1988776	hsa-miR-509-5p	CLIP-seq
MIRT974579	hsa-miR-519a	CLIP-seq
MIRT974580	hsa-miR-519d	CLIP-seq
MIRT974583	hsa-miR-544b	CLIP-seq
MIRT2680442	hsa-miR-548aa	CLIP-seq
MIRT974584	hsa-miR-548ah	CLIP-seq
MIRT974586	hsa-miR-548o	CLIP-seq
MIRT974587	hsa-miR-548s	CLIP-seq
MIRT1988777	hsa-miR-612	CLIP-seq
MIRT1988778	hsa-miR-661	CLIP-seq
MIRT1988779	hsa-miR-766	CLIP-seq
MIRT974594	hsa-miR-873	CLIP-seq
MIRT974595	hsa-miR-93	CLIP-seq
MIRT2527056	hsa-miR-933	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
EGR1	Unknown	10707957;8576248
JUN	Unknown	11057875
JUND	Unknown	11057875
NFKB1	Unknown	11057875;11157486;19167713;9867853
REL	Unknown	11057875
RELA	Unknown	11057875;11157486;19167713;9867853
SP1	Unknown	10707957;8576248

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	17898544
GO:0002020	Function	Protease binding	IPI	3455766
GO:0002541	Process	Activation of plasma proteins involved in acute inflammatory response	IDA	17469850
GO:0002543	Process	Activation of blood coagulation via clotting cascade	IDA	17469850
GO:0004252	Function	Serine-type endopeptidase activity	IDA	24998411
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	8598903, 8940045, 9414278, 15522303, 15664864, 16959886, 20634491, 25241761, 28514442, 32296183, 33961781
GO:0005543	Function	Phospholipid binding	IDA	17469850
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	19065458
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	NAS	10896200
GO:0005886	Component	Plasma membrane	TAS
GO:0006950	Process	Response to stress	IEA
GO:0007596	Process	Blood coagulation	IDA	8632006, 24998411
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0009897	Component	External side of plasma membrane	IDA	17469850
GO:0009986	Component	Cell surface	HDA	19581412
GO:0009986	Component	Cell surface	IDA	17898544
GO:0010628	Process	Positive regulation of gene expression	IMP	22556343
GO:0010641	Process	Positive regulation of platelet-derived growth factor receptor signaling pathway	IDA	17991872
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	3037536
GO:0016485	Process	Protein processing	IDA	24998411
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0030335	Process	Positive regulation of cell migration	TAS	18612547
GO:0031012	Component	Extracellular matrix	IDA	2704749
GO:0032008	Process	Positive regulation of TOR signaling	IMP	18612547
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	22556343
GO:0045766	Process	Positive regulation of angiogenesis	IDA	17898544
GO:0050927	Process	Positive regulation of positive chemotaxis	IDA	17991872
GO:1905286	Component	Serine-type peptidase complex	IPI	24998411
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	17898544

MIM	HGNC	e!Ensembl
134390	3541	ENSG00000117525

P13726

Protein name

Tissue factor (TF) (Coagulation factor III) (Thromboplastin) (CD antigen CD142)

Protein function

Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited proteolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly a

PDB

1AHW , 1BOY , 1DAN , 1FAK , 1J9C , 1JPS , 1O5D , 1TFH , 1UJ3 , 1W0Y , 1W2K , 1WQV , 1WSS , 1WTG , 1WUN , 1WV7 , 1Z6J , 2A2Q , 2AEI , 2AER , 2B7D , 2B8O , 2C4F , 2CEF , 2CEH , 2CEZ , 2CFJ , 2EC9 , 2F9B , 2FIR , 2FLB , 2FLR , 2HFT , 2PUQ , 2ZP0 , 2ZWL , 2ZZU , 3ELA , 3TH2 , 3TH3 , 3TH4 , 4IBL , 4M7L , 4YLQ , 4Z6A , 4ZMA , 5W06 , 6R2W , 6Z9W , 8CN9 , 8QOD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01108	Tissue_fac	17 → 118	Tissue factor	Family
PF09294	Interfer-bind	138 → 245	Interferon-alpha/beta receptor, fibronectin type III	Domain

Tissue specificity

TISSUE SPECIFICITY: Lung, placenta and pancreas. {ECO:0000269|PubMed:12652293}.

Sequence

METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE
CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS

Sequence length

295

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISSECTION, SPONTANEOUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSEMINATED INTRAVASCULAR COAGULATION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VON WILLEBRAND DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (513)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	10769107, 10871461, 11165549, 11943934, 12520697, 12571435, 12680634, 15650545, 16479199, 18854273, 19105233, 22882730, 23188048, 25407022, 8735142, 8990627, 9128263, 9716147 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	16239598, 16461845, 18292391, 21557685, 25056722, 25963480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	16239598, 16324758, 18217146, 18292391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute fatty liver of pregnancy	Fatty Liver	BEFREE	29297090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27605400, 31090597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	15474155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27923687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10480290, 11775254, 11779431, 14597990, 18802482, 20133705, 26374632, 28343272, 30234545, 31434194, 7949172, 8289480, 8555488, 9269772, 9639510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	16206674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12174921, 21693061, 28055955, 29539580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15814630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21619686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10417560, 16937466, 27721473, 28938620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	22929889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19921488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	12589025, 21042291, 30126944		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	24025420		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	24025420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15975770, 18813964, 18830724, 35849618, 40183343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	17463335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	8646688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28879581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	26854437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28988646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Iron Deficiency	Iron deficiency anemia	Pubtator	11954010	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	9576754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	18983524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	12652293, 15073034, 15795541, 18983524, 29614638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	16409458, 7888247	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	12871422, 16409458, 7888247	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	14640893, 21557685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	12093767, 12871422, 21557685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioedemas, Hereditary	Angioedema	BEFREE	8560420		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23754313, 25963480, 31048498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	10769107, 12780700, 15456541, 17536017, 21794077, 22964479, 23328933, 29716893, 30185417, 30194751, 30278301, 30549270, 31103268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	12871461, 15226179, 15456541, 16385547, 16968331, 24332063, 30549270	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	21794077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antithrombin III Deficiency	Antithrombin Deficiency	BEFREE	30986390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17764874	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29571624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	19847139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	LHGDN	18677291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	10807755, 12871422, 15173027, 16479457, 16531802, 18236227, 18691491, 19515372, 22196362, 26178021, 28749986, 29037842, 29225295, 29545340, 30498683 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12632417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11954010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34394126	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20150920, 22828416, 29545867, 29920622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22828416	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	33506909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15735028, 19276385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	32755029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10623647, 11157486, 11978801, 12871381, 17127486, 19515372, 19592462, 20103969, 21257914, 21483174, 21812913, 23782925, 28749986, 29545340, 30789451, 33814512, 9818004 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	10807755, 12871422, 15173027, 16479457, 16531802, 18236227, 18691491, 19515372, 26178021, 28749986, 29037842, 29225295, 29545340, 30498683, 30669336 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	11776298, 14610342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18541003, 36517180	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	LHGDN	14678810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20458440, 2591021, 28065908, 28471981, 28747025, 29595637, 30530119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	28471981, 29595637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	18802482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	28492644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34390642, 36448207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21794077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22300769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26592196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	37848613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	14665710		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	27228385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	30772379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30579699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	10027315, 10623647, 11157486, 11532095, 12139748, 12871381, 14640893, 14675092, 14717972, 15546947, 15882267, 16507316, 16930953, 16982920, 17213471 View all (73 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	10480290, 10541197, 1174709, 1242430, 15320811, 19390612, 20013532, 20133705, 27592310, 27892596, 28024455, 28338598, 28737691, 28855397, 29621007 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	19276385, 26854437, 27629739, 32680988, 36696180, 39846164	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	32678428, 37589138	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	36384269, 36702064, 8097120, 8408693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	17425664	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	30772379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	34471635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	23782925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25450387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26687818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Thrombus	Cerebral Thrombus	BEFREE	31270150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10481940, 15562024, 19074826, 20434002, 20504328, 20830515, 21059650, 21458031, 21840575, 22534171, 23287882, 23320987, 23409769, 23801760, 25407022 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	15562024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10901365, 14717972, 16238103, 17470200, 19074826, 21059650, 21387303, 21761355, 22534171, 22616941, 23593114, 23828406, 24568471, 25183703, 25447311 View all (20 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	17166244	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	36806722, 8529094	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21531894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary Leak Syndrome	Capillary leak syndrome	Pubtator	12149215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	14613581, 21487519, 27496222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12174921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25552913, 33618227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	31962001	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30579699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	26722600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21801068, 26919453, 29715083, 30634531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27755234, 28148395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32997974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17211468	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25251954, 27755234, 34326314, 34452748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16380413, 21543928, 21725665, 24094893, 27755234, 28148395, 28417928, 28501328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	15808768, 25668326	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	15808768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	15808768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	15546947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	12139748, 19592462, 29545340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16461845, 17425664, 18284603, 18339698, 20150920, 20174754, 25963480, 26286125, 28109788, 28492698, 28749986, 29376474, 30064684, 30113368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17331567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30113368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	17969370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	BEFREE	28482260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	28539835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	18033956, 27356567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	37063881	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	25931463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	14987914, 19203804, 26286125, 28107809, 29376474, 31130187, 31265843, 9353321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	18000605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	38511328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21693061, 30402151, 31796521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21693061, 30402151, 31796521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chiari malformation type II	Chiari malformation	BEFREE	20664910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31090597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19921488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	21037076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	21037076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroidal Neovascularization	Choroidal neovascularization	Pubtator	11979237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30320415, 31555705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29167396, 30324315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	26163243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28611261, 9863491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	21739268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coagulation factor deficiency syndrome	Coagulation Factor Deficiency Syndrome	BEFREE	30312027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21717035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	16461776, 24966616, 31774347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16453151, 18548257, 22052255, 22076613, 22166631, 23233043, 23494077, 23666757, 9361850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	9820166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10640960, 21404058, 22052255, 22076613, 22166631, 23494077, 29127473, 29715083, 31774347, 9311608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11921018, 15494427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11921018, 17566019, 21625939, 23233043, 23536887, 28865443, 29226599, 29600973, 30462538, 30462558, 30664196, 31604930, 31724326, 31774347, 32957968, 33572915 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36806722	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Compartment syndromes	Anterior Compartment Syndrome	BEFREE	28443568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	24199192, 27542852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	12426405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	CTD_human_DG	7740478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28727370, 31263677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10398162, 10830219, 21713319, 22703881, 28877957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	10440909	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	10830219, 16409458, 18571179, 21557685, 21713319, 22703881, 28877957		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	14675092, 19093728, 19515372, 22938499, 37589138, 9922347	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	18217146		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	11869845, 16507316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10830219, 16409458, 18067591, 21713319, 22703881, 25056722, 28877957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	23782925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	10712418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	26163243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	8408693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	CTD_human_DG	14967414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	16038715, 19095643, 23321260, 25881103, 26517864, 28574332, 29409258, 29789989, 30986390, 31770151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of butyryl-CoA dehydrogenase	Deficiency Of Butyryl-CoA Dehydrogenase	BEFREE	27236113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	2293902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	21488867	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	37377751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	16461845, 18725234, 23136988, 28091589, 29477147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16461845, 18725234, 23136988, 25963480, 27127202, 28091589, 29477147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17969370, 21935671, 30113368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24378263, 27127202, 29477147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33029194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	15203887, 26271343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24378263, 25861467, 26742564	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16820938, 17334638, 20200314, 21935671, 26742564, 27827396, 28246677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	18000605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	24332063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	38374020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	15098027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	10393965, 11740383, 15213854, 15389118, 15992667, 16038715, 16411400, 16634740, 19794520, 21415824, 22713531, 25673638, 26410136, 27940211, 28236427 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	12139748, 12487787, 14675092, 16634740, 26241501, 3025256, 31416821, 7513203, 8182139, 8224211, 8486155, 9531596	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	CTD_human_DG	20642682, 7740478, 9134660		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27436115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	26763081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29341787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22672593, 27989989, 28681683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	27807692, 36660246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	39178205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Ataxia	Episodic ataxia	Pubtator	9576754	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21543928, 28148395, 28417928, 28501328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	21801068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19424642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	14613581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	19424642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	14613581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	30472780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor V deficiency	Factor V Deficiency	BEFREE	10726026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor V Deficiency	Factor v deficiency	Pubtator	18695002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Factor VII Deficiency	Factor vii deficiency	Pubtator	15456489, 8204879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Thrombotic Thrombocytopenic Purpura	Thrombotic thrombocytopenic purpura	CTD_human_DG	7740478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	BEFREE	31027837, 7579461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	22556343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	12753293, 18007150, 19794520, 2324115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	10216089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21037076, 28883694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	34301297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	34301297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Foramen Ovale, Patent	Patent foramen ovale	BEFREE	19203804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	11869845, 24350254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	22929889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	28497645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	19401404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	36727359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10864205, 16849552, 17470200, 19276385, 20462964, 33057845, 36806722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15735028, 16849552, 19276385, 19624457, 22682129, 23384223, 25450387, 25627976, 29333924, 8646688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15735028, 16849552, 19276385, 19624457, 20462964, 22682129, 23384223, 25450387, 25627976, 28951589, 29333924		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	10864205, 16849552, 20462964, 26526635, 32757451, 33130899	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	11876468, 12135696, 19074872, 19958818, 23384223, 25450387, 27664011, 28668420, 28951589, 30266764, 8646688		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gliosarcoma	Gliosarcoma	Pubtator	7485395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	16285898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	16285898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	26722600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	25789325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	25668326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	8917233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	30113368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18521506, 18645927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemihyperplasia Isolated	Hemihyperplasia	Pubtator	36517180	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	25352340, 25457201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	15842359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23269489	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	LHGDN	15842359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	23642803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	12858167, 18055866, 18500941, 19563500, 26727350, 28550758, 31336410, 31383642, 3983911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	32430703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	16427374, 18055866, 20305539, 23492913, 26952654, 28772338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	18055866, 18500941, 26727350, 28550758, 31336410, 31383642, 3983911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	19563500, 21370218, 25086657, 28343272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heparin Cofactor II Deficiency	Heparin cofactor 2 deficiency	Pubtator	11493478, 22394597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heparin Cofactor II Deficiency	Heparin cofactor 2 deficiency	Pubtator	21848694	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	30867825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	30664196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Factor V Deficiency	Hereditary Factor V Deficiency	BEFREE	10726026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Factor XI Deficiency	Hereditary Factor XI Deficiency	BEFREE	10541197, 7235815, 8749944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Factor XIII Deficiency	Hereditary Factor XIII Deficiency	BEFREE	28801214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	17158640, 37935654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Homocystinuria	Homocystinuria	BEFREE	8592550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28350198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	15629370	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	22214850, 28142075, 30341732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	22214850, 28379034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	25375118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	17127486, 25042561	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25042561, 29307595, 29351188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	11254667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	17127486, 25042561	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	25042561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31616219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	22214850, 28379034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	19623180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	12468567, 15968404, 16461845, 18339698, 29470366, 31616219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17586694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	28137735, 29742907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	18841289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodysfibrinogenemia	Hypodysfibrinogenemia	BEFREE	22836883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	BEFREE	30885617, 31027837, 7579461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	30264480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16849552, 20606312, 30634531	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25569083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	25375118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30429407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	18023719, 19074872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31472398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15947544, 31774347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	16461776, 8408693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	22533697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intravascular hemolysis	Intravascular Hemolysis	BEFREE	12571435, 18983524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	18395717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29132816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	11701151, 18033956, 19203804, 28482260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	26191280	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	25963480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	24350254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	9701458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	31555705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	9922347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29608549, 30289129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	14610342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30320415, 31555705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34445498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	26722600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	22556343		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12138373, 18023704, 20504328		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17577783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	28343272, 7949172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	33637692, 9639512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24104188, 8555488	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	20133705, 28343272, 7949172, 9269772, 9639510, 9639512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15213854, 2617479, 28406995, 8555488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	31221660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	31158377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28841839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22340235, 24853422, 29061995, 30113368, 30931258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	10216089		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	LHGDN	17982314		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	25884329	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28611261, 9863491		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	16570355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25884329, 29106686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	9863491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10027315, 24200043, 31755376, 34205482, 34925645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	11959915, 15386437, 18594312, 19661141, 28106852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	22664050, 27320770, 28316135, 28603894, 28640321, 30092725, 30194751, 30467688, 31102433, 31821738, 7703480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	16230147, 3689698, 9701458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12555213, 12780700, 21794077, 30563869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	16230147, 3689698, 9701458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12780700, 16230147, 17261530, 21794077, 22196362, 24436371, 30185417, 30563869, 3689698, 9701458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	31319876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	16230147, 3689698, 9701458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	LHGDN	17066404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24491425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37935654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular degeneration	Macular Degeneration	BEFREE	30126944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	34406330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	30244327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19958818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	10885426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	9186598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15562024, 19074826, 20434002, 20504328, 20830515, 21059650, 21458031, 21840575, 22534171, 23287882, 23320987, 23409769, 23801760, 25407022, 25447311 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	15562024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19424642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29715083, 30634531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28841839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16380413, 21725665, 24094893, 28148395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16937466, 18023707, 18645921, 21917301, 22547577, 25963480, 28843831, 29028284, 29656167, 29767505, 30113368, 30816521, 31327867, 31348600, 9766679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11593034, 16230147, 18091328, 18841289, 19492160, 20013532, 29066620, 29427323, 29716922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22929889, 28833193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30579699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12115343, 12470148, 12649087, 14665359, 15034795, 15098027, 15117736, 15494427, 15562024, 16038715, 16236262, 16479463, 18023707, 18023719, 18028765 View all (74 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21693061, 30402151, 31796521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18548257, 22052255, 22076613, 22166631, 23233043, 23494077, 23666757, 9361850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	15562024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15562024, 16894464, 18031796, 18612547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	15562024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20504328, 29111325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	15562024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19921488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	25163932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10456459, 10873516, 11816709, 11959915, 14500372, 1465406, 15386437, 28055955, 31467489, 7667269		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12028585, 12192302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20505748, 26504080, 30586386, 6585826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24778320	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	40003901	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	12883669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	2293902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23539451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	10885426, 31755376, 7485395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20103969, 21483174	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	15386437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	14665359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	31472398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	17536017, 29103803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	26733571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	30640949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35682458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26489695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	17640852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	16959024	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	10712418, 12652293, 15488883, 17008590, 19811432, 9353321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	11389008	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	11816707, 16516912, 17008590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	16507316, 21557685, 22167343, 25375118, 25660055, 26191280, 26346032, 29504899, 7888247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16286589		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	19027114, 31757633		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	26191280	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	LHGDN	18495150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26163243, 28234145, 30479022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	35271862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	17495120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	32920806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10417560, 10456459, 10885426, 10922073, 11171553, 11593034, 12023851, 12115343, 12649087, 1465406, 14665359, 14717972, 15034795, 15098027, 15330168 View all (87 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	28951589, 29264878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	LHGDN	17469034		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome	Nephrotic Syndrome	CTD_human_DG	17513194		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	18325115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31807159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	40183343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30827122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	30472780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30472780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	31158377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	18594312, 19661141, 22237453, 28055955, 28419722, 28604784, 30664196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10865847, 17425664, 20174754, 29071721, 31806688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17425664, 25861467	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	26763081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17509570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26763081, 28988646, 29949655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ostium secundum atrial septal defect	Secundum atrial septal defect	BEFREE	19203804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	16380413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	28501328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian hyperstimulation syndrome	Pubtator	8816625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16380413, 21725665, 24094893, 28148395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19904262, 21725665, 25886038, 30549251, 8490170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16937466, 18023707, 18645921, 21917301, 22547577, 25963480, 28843831, 29028284, 29656167, 29767505, 30113368, 30816521, 31327867, 31348600, 9766679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	15814630, 23754313, 25963480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16937466, 18023707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	25963480, 28834179, 29767505, 31393055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16937466, 27404454, 32928856, 36806722, 37651191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30113368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	16937466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24690883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28769539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	29929491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	21488867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	27057091	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34183495, 35397550	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	19625260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	18033956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	39982832, 9466567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	10885426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27035648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28088464, 28795250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	16959024	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	12780700, 15226179, 15456541, 17261530, 18802482, 21794077, 22933620, 22964479, 28734155, 29103803, 30194751, 30278301, 30405613, 30549270, 31040845, 31090599, 31103268 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	28611261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	31774347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	31090597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prekallikrein deficiency	Prekallikrein Deficiency	BEFREE	21415712, 31530337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	31774347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16230147, 18091328, 18841289, 19492160, 20013532, 29066620, 29427323, 29716922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12036889, 18091328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12036889, 24517338, 28249598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	29264878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31616219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Edema	Pulmonary edema	Pubtator	17356058	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	20971733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Thromboembolisms	Pulmonary thromboembolism	BEFREE	30412837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	CTD_human_DG	7740478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	12408769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31263677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	23136988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	21531894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	LHGDN	18310227, 18490736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	21531894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	21531894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	37925496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28275964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	21617868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20442298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma Alveolar	Rhabdomyosarcoma	Pubtator	38102136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12632417, 18395519, 23490466, 29794013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rosacea	Rosacea	Pubtator	34290700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28784104, 30125801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	7507301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	30772379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	12139748, 16634740, 26241501, 28024455, 3025256, 37263122, 7605983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	32496420	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11171553, 11685190, 12529760, 15117736, 15389118, 16479457, 16634740, 20153022, 23249930, 25407675, 26241501, 27753793, 28024455, 28492702, 28802974 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	7667269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	31106406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	14521455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	28855397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	30563869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	36517180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	22237453, 29110838, 30412630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	11216916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 15 autosomal recessive	Spastic paraplegia	Pubtator	30081747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	30081747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25857630, 28841839, 35775375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36806722	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27841803		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	27236113, 30875490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	21557685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22929889, 28833193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17066404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22901134, 22929889, 23801858, 24317510, 30517360, 33572915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	25931463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	19367158, 28350198, 29972859, 31604650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	27228385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	16959024, 17577920, 27243342	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	24009132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	19105233, 26945263, 27243342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	11493478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	12555213, 16937466, 2211593, 27127202, 32940892, 37298168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	32574263	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	10830219, 11342462, 12680634, 15213854, 15494427, 15706469, 15795541, 15860742, 16131459, 16409458, 16409467, 16479463, 16777761, 18521506, 18645927 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	12139748, 15860742, 16570355, 17764874, 17895509, 21848694, 25886038, 32928856, 34452748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	22052675, 7888247	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	10623647, 11157486, 12871381, 14630829, 14675092, 15333031, 15489087, 15978105, 16385547, 16507316, 16846490, 16930953, 16959024, 16968331, 17166244 View all (60 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	22938499, 27243342, 28471981, 29595637	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	19535796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	34622829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	14665710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	12555213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	19203804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25801992, 28938620, 29622581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37686305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31774347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	23269489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	1904059, 2002014, 36806722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	LHGDN	18802362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21693061, 35262965, 35589407, 36806722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	22556343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	12470148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35865532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	21042291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10880382, 18725234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	12871314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	15996056, 16697385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	19592462, 26667361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	32430703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	8408693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	19552639	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	17166244, 17211468, 17408407, 17883594, 22520016, 27404454, 27755234, 31734835, 36384269, 36399711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	24339944, 32928856	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	22533697, 25891834, 36474713, 36624716	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	18974383		★★★★★ ★☆☆☆☆ Found in Text Mining only
von Willebrand Disease	von Willebrand disorder	BEFREE	27785858		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Werner Syndrome	Werner syndrome	Pubtator	448174	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

F3 (coagulation factor III, tissue factor)