ETDA (embryonic testis differentiation homolog A)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 101928677 |
| Gene name | Embryonic testis differentiation homolog A |
| Gene symbol | ETDA |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | X |
| Chromosome location | Xq26.3 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q3ZM63 |
| Protein name | Embryonic testis differentiation protein homolog A |
| Family and domains | |
| Sequence |
MDKEVPKGSPREPALNIKKSDKSFKRKKPTENVLIFLINRQLGRHRSDIDLSRWVWMLS |
| Sequence length | 59 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with ETDA across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ETDA (see Related Genes above), that are NOT already directly curated for ETDA itself -- a lead worth checking, not a confirmed association.
0
|
|